<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09557

Description Cyclin-dependent protein kinase
SequenceMASNSILTLGSYKNRKLISKKTILDTYKILGYIASGTYGKVYKAEYRSGSFNNNKTTTINSNANSNANSNTNHKNNHDLKKLLFAIKKFKGDSRDGEILHYTGLSQSACREIALSKELKHENIIQLVEIVLEKKSIYIVFEFAEHDLLQIIHFHSQNGLKPIPEFSFKSIMWQILNGVSYLHQNWIFHRDLKPANIMVTYDGIIKIGDLGLARKFDNPLQNFYTGDKVVVTIWYRAPELLLGGRHYTPAIDLWAVGCILAELLALRPIFKGEEAKIENRRTIPFQTNQMFKIIEILGKPTVKNWPTLDKYPEYQHLQNFKAYSNKLLTWFHNIGQSNSNLFSLLQTLLEYDPAERIAAYDALVHQYFLEPPYVSTNAFDGLPFKYPRRKITTDTTDLLQLQNKNYKRNPNDLDAISSRKRQKV
Length423
PositionKinase
OrganismAscoidea rubescens DSM 1968
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Ascoideaceae> Ascoidea.
Aromaticity0.11
Grand average of hydropathy-0.400
Instability index36.76
Isoelectric point9.46
Molecular weight48786.41
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity	GO:0004693	IEA:EnsemblFungi
RNA polymerase II CTD heptapeptide repeat kinase activity	GO:0008353	IEA:EnsemblFungi

GO - Biological Process
negative regulation of filamentous growth	GO:0060258	IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay	GO:0070481	IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain	GO:0070816	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose	GO:0000435	IEA:EnsemblFungi
protein destabilization	GO:0031648	IEA:EnsemblFungi
response to oxidative stress	GO:0006979	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09557
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.47|      33|      34|     312|     344|       4
---------------------------------------------------------------------------
  312-  344 (58.33/38.21)	EYQHLQNFKAYSNKLLTWFHNIGQSNSNLFSLL
  349-  381 (58.14/38.06)	EYDPAERIAAYDALVHQYFLEPPYVSTNAFDGL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09557 with CDK8 domain of Kingdom Fungi
Unable to open file!