<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09552
| Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
| Sequence | ESDLAALYPPPPPYYKFFTAENIDKAKIWLKENEDSYNDDNDETNYPKEEFRFLIPPKKPTGPHYRCFGNIWPFDDKIPTLKEQNIPQLYQDITSSQHGQDPTQVELEKLTKSLLVVFLEIIGIISINPNVYQENLERLRIILINIHHLLNEYRPHQSRDTLKLLLEKQIDIKNREIMKIDNDCKVVKDKIFKIVE |
| Length | 196 |
| Position | Middle |
| Organism | Ascoidea rubescens DSM 1968 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Ascoideaceae> Ascoidea.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.638 |
| Instability index | 36.61 |
| Isoelectric point | 5.47 |
| Molecular weight | 23191.25 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP09552
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.34| 12| 47| 7| 18| 1
---------------------------------------------------------------------------
7- 18 (28.97/13.96) LYPP.PP..PYYKFF
54- 68 (19.37/ 7.48) LIPPkKPtgPHYRCF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.24| 10| 14| 119| 128| 2
---------------------------------------------------------------------------
119- 128 (17.23/10.40) LEIIGIISIN
136- 145 (17.02/10.20) LERLRIILIN
---------------------------------------------------------------------------
|