<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09551

Description Mediator of RNA polymerase II transcription subunit 6
SequenceMGDKLVLDELQWRNPEWIQMFGINTDNVLDYFSQSPFYDRTSNNQVLKMQAQFSENFYNRNLLSELKKMTGTEFIVAHVKEPDFWIIRKQNRLSINETVPIADYFIIGVNIYMAPTIHSIVQSRLLNTCLALRNSLDSIRNLAYFSPSQGHGYIVDPNMDSINESNNATNATNNNASQTSTIPINDSSVNLSQTQKSNTESQSAIDESVIQAQPSVIFDQLIKVTYKNQKPY
Length232
PositionHead
OrganismAscoidea rubescens DSM 1968
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Ascoideaceae> Ascoidea.
Aromaticity0.09
Grand average of hydropathy-0.440
Instability index43.95
Isoelectric point5.19
Molecular weight26471.35
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. 


ECO:0000256	PIRNR:PIRNR013286

GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi

GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly	GO:0051123	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.34|      17|      18|      32|      49|       1
---------------------------------------------------------------------------
   32-   49 (26.84/22.29)	FSQSpFYDRTSNNQVLKM
   53-   69 (30.50/19.42)	FSEN.FYNRNLLSELKKM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.17|      16|      24|     158|     175|       4
---------------------------------------------------------------------------
  158-  173 (27.07/19.24)	NMDSINESNNATNATN
  185-  200 (26.10/11.14)	NDSSVNLSQTQKSNTE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09551 with Med6 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) DPNMDSINESNNATNATNNNASQTSTIPINDSSVNLSQTQKSNTESQSAID
156
206










Molecular Recognition Features






MoRF SequenceStartStop




NANANA