<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09548
| Description |
Uncharacterized protein |
| Sequence | MSDSQSQIADPKIFENTVKELSTDIILKTRQILKIIESLPGAGVSTDDQLNTINLLQNQLIQLEKKRLQKIDEKNNLLLICNDLIHQVTDGLCNSNT |
| Length | 97 |
| Position | Middle |
| Organism | Ascoidea rubescens DSM 1968 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Ascoideaceae> Ascoidea.
|
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.308 |
| Instability index | 39.25 |
| Isoelectric point | 4.96 |
| Molecular weight | 10901.37 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP09548
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.89| 15| 21| 48| 62| 1
---------------------------------------------------------------------------
48- 62 (25.27/14.48) DQLNTINLLQNQLIQ
72- 86 (26.62/15.59) DEKNNLLLICNDLIH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.65| 13| 21| 12| 24| 2
---------------------------------------------------------------------------
12- 24 (22.01/15.18) KIFENTVKE.LSTD
34- 47 (17.65/11.13) KIIESLPGAgVSTD
---------------------------------------------------------------------------
|