<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09545
Description |
Cyclin-like protein |
Sequence | MSISYNINLRIYLHKCLLTLSRKLNLKIQPVATAQIYLSRFLITVSIKEINLYLLIATCVYLACKIEESAHHIRTVLSESRNLWPEFIPNDITKLAEFEFYLIDELEHCLVVHHPYKSLIQLKNVLSTYDFQILAGSNEDTTLVNANSVANNKAYSSENNLLASTLMNNSGSSASSLSIKNIQLTDDEIQAAWSFINDSYITDLPLIVPPHIIAISSIFLSIFISKKLSMSNYLNLIKQNERLLFLINFIAFSKINLNQIIESIQEILILYESWSKYDEKSIKDDIKFLLLNR |
Length | 293 |
Position | Kinase |
Organism | Ascoidea rubescens DSM 1968 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Ascoideaceae> Ascoidea.
|
Aromaticity | 0.10 |
Grand average of hydropathy | 0.186 |
Instability index | 44.16 |
Isoelectric point | 6.17 |
Molecular weight | 33585.57 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP09545
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.10| 21| 22| 12| 33| 1
---------------------------------------------------------------------------
12- 33 (32.16/25.59) YLHKCLLTLS.RKLNLKIQpVAT
37- 58 (30.94/18.83) YLSRFLITVSiKEINLYLL.IAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.74| 17| 21| 142| 159| 2
---------------------------------------------------------------------------
142- 159 (24.27/17.73) TLVNaNSVANNKAYSSEN
165- 181 (28.47/16.40) TLMN.NSGSSASSLSIKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.53| 20| 21| 246| 265| 3
---------------------------------------------------------------------------
223- 238 (18.94/ 7.06) ...FIS.KKLSMSNYLNLIK
246- 265 (30.96/15.37) LINFIAFSKINLNQIIESIQ
268- 287 (32.64/16.53) LILYESWSKYDEKSIKDDIK
---------------------------------------------------------------------------
|