| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MKSNMTGMEYILLHVQEPILYVIRKQHRFSTSQVTPIADYYIIAGVVYQAPDLGSVVNSRLLNSVNHLQSAFDECLSYTRYHPSKGYSWEFKDKDLDEKGQKDKKPDVPSSLFQRQRVDMLLVELSKKFPPRLLQIDSGPSPSQKSQNTAPTTNSNSSSSNGSTTNATGEVQIKQEPNTGPASESGGGKSTSGPGSNEPPVIIKQEKIEPSMVPCTNSTGTGVPSINATSGQQQGPNMKPPPEKRPRL |
| Length | 248 |
| Position | Head |
| Organism | Orchesella cincta (Springtail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola> Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.740 |
| Instability index | 47.69 |
| Isoelectric point | 8.94 |
| Molecular weight | 27091.09 |
| Publications | PubMed=27289101 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09531
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 139.38| 29| 58| 145| 184| 1
---------------------------------------------------------------------------
156- 184 (50.05/32.46) NSSSSNGSTTNATGEVQIKQ...EPNTGPASE
187- 216 (39.25/10.82) GGKSTSGPGSNEP.PVIIKQekiEPSMVPCT.
217- 243 (50.07/16.83) NSTGTGVPSINATSGQQ..Q...GPNMKPPPE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) NMKPPPEKRPRL 2) VIIKQEKIEP | 237 201 | 248 210 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab