<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09514

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMMKQSNFAAGMASPAQLGGGGPQLAMMDRNPMTPGGLALSHSQGTPMPPQGQSGQLMVAQQQPPGSSISLALLIDFIVQRTYHDLTVLAELLPRKTDMERKQEIFSFSARTRLLAVRLLGLVKWASSAAKVDKSVHIMGFLEKQSMLFVETADFLSRMARETLVHARLPNFHIPAAVEVLTTGTYNRLPNCIRERIVPPDSISTSEKKFVLSKLNQVILHRLVTTELPSQMRNLKIEQGRVVCRVENEFEVSLTVLGDSPNSPWRIIEIDILVEDKEIGDGMSLVHPLQINYMHSLAQSRIDNSSAPLRELYDILHAFAQSLQLEVLYSQVLKLCRERLGDFLSVEEYTVGRSIILGYWRELSALDPKAELGYRVIISVDFNDPAQPLGVSHQPPLSSDETVQTGEGLKNNQLEKILVQTVYLRSKNRLTELRKEVEHFLGMDCSLQGSPPILSIPILTHCLRSEQLLVAVNIHTGSYLVHIPQFEPSPPVVNDIQQALNSINPDPVKLKALLSQLRYWVTEKRCEKTLQHLPASCSEKITLLTWNENPILNKIGAHKLTIKFQKHPYAILIVEFKEKEDQPNEMDYFFYLIMVKKASADETEALPAGATVGGSVPKFYLKPTTTIPLDTFAATHGSFTDVDAKDSLGSGATHLPGQKHSEPSFKKFKHPAYFVPELAHIVAMCDERLPFALLMSELSNREIIHGGCMIQANGSSLAIPVLRFPMVLSNVPQSTLDKLHTQLDSAYIRYQTQLRGFRTWNLELKFSSMPGSTTPGVEKPLNFGYDMTVSSEEHIPKVVDTAPISVKSYSWNKLIISYGPNKAAIVTVQYSITEKVYKLSFGGNTSHNPHTLLRVHLQQYINSTTGSLDGLMKLLNETYEPLYSLIKLPTTPQLGVMYSRPQIPVQTFVLVPHSIYHIRIVYCSVYCLDVTFQSDGLVSIRDGAYSQFDKTSVLGEFFPTQGLKAFLSKYVDENAVFRRRSQSEDDNPPSPISTLLEMDHNVGTPGGGSASPFMSAKPSSPAPGRSNPHTPASPHIPQPNPTGYSPATSLANLASPPSLSHLSQQSPNPSASMLPHPVPSPSAMLPAPSPSGGPLSVPTPSPNPNPHHNTSSHGPASAMASLGNTSHPSPFFHADSSPAPAQSPWASAGSPGMPRPSPARVGHSPQSGQMENRVNLAHNRVLPQRSWAGAIPTILTHDALDILCTPSADSTPGNANYPCRPLERFLGCSYLRRQLQRIVQSEEHLHLLNQQEPGVILFRSDTMQFRLLETFFMTKVVCPPFRPNGVSAFLKMISLPSRIIRDCIQIIRLQLNPSIIEQHNWKWGVQLCLTVPPSAMPIIPPGMPAIVTSQSKILLYLLLTRAQSGHSDVQPMEIDSINLSDPDKVPFIMVPLIHEITTNMTQLAEKRAMGPPPPEYAVVAQQLRRFSDFNQGNMMECSIFPSVQELLSNLALPPDTPVQQPNQPPPIQQPLPQPMQPVPGAGPMVRPPMGPMMTPGQQFSGPHTPHSMGGPGSGPMM
Length1516
PositionTail
OrganismOrchesella cincta (Springtail)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola> Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella.
Aromaticity0.07
Grand average of hydropathy-0.203
Instability index56.09
Isoelectric point7.49
Molecular weight167047.29
Publications
PubMed=27289101

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09514
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.89|      15|      20|    1066|    1080|       1
---------------------------------------------------------------------------
 1066- 1080 (32.78/12.32)	PNPSASMLPHPVPSP
 1087- 1101 (28.27/ 9.48)	PSPSGGPLSVPTPSP
 1476- 1489 (22.84/ 6.07)	PVPGAGPMVRP.PMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     263.96|      46|     115|    1010|    1060|       2
---------------------------------------------------------------------------
   13-   55 (41.64/10.02)	........SPaqlggggpqlaMM.........................DRNPMTPG...................GLALSHSQGTPMP.PQ..GQSGQ.
 1010- 1047 (70.10/22.00)	........SP...........FM.........................SAKPSSPAPG...............RSNPHTPASPHIPQPNPT..GYSPAT
 1048- 1119 (31.65/11.44)	SLANLASP...............pslshlsqqspnpsasmlphpvpspSAML..PA..pspsggplsvptpspNPNPHHNTSSHGPA........SAMA
 1120- 1166 (81.40/27.60)	SLGNTSHPSP...........FF.........................HA.DSSPAPA...............QSPWASAGSPGMPRPSPArvGHSPQS
 1490- 1514 (39.17/ 8.98)	.........P...........MM..............................TPGQQ...............FSGPHTPHSMGGPGSGP.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     284.44|      96|     328|     843|     966|       3
---------------------------------------------------------------------------
  728-  840 (145.28/78.77)	SNVPQsTLDKLHTQldsAYIRYQT.QLRGF.RTWN..LELKFSSMPGSTTP..GVekplnfgydmtVSSEEHIP.KVVDTAPISVKS....Y.SWNKLIISYGPNkaAIVTVQYSITEKVYKLSF
  845-  952 (139.16/140.55)	SHNPH.TLLRVHLQ...QYINSTTgSLDGLmKLLNetYEPLYSLIKLPTTPqlGV...........MYSRPQIPvQTFVLVPHSIYHirivYcSVYCLDVTFQSD..GLVSIRDGAYSQFDKTSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     129.41|      37|      40|     416|     452|       4
---------------------------------------------------------------------------
  416-  452 (63.55/43.07)	ILVQTVYLRSKNRLTELRKEVEHFLGMDCSLQGSPPI
  455-  491 (65.86/44.95)	IPILTHCLRSEQLLVAVNIHTGSYLVHIPQFEPSPPV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.42|      24|      51|    1390|    1413|       5
---------------------------------------------------------------------------
 1390- 1413 (44.58/23.95)	PLIHEITTNMTQLAEKRAMGP..PPP
 1440- 1465 (39.84/20.47)	PSVQELLSNLALPPDTPVQQPnqPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.96|      11|      40|     600|     610|       6
---------------------------------------------------------------------------
  600-  610 (18.25/ 9.28)	DETEALPAGAT
  642-  652 (16.71/ 7.81)	DAKDSLGSGAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.99|      17|      17|     154|     170|       7
---------------------------------------------------------------------------
  154-  170 (30.67/21.45)	FLSRMARETL...VHARLPN
  171-  190 (26.32/17.24)	FHIPAAVEVLttgTYNRLPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.65|      17|      19|     280|     298|       8
---------------------------------------------------------------------------
  280-  298 (28.41/19.02)	DGMSlvHPLQ..INYMHSLAQ
  302-  320 (26.24/11.98)	DNSS..APLRelYDILHAFAQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09514 with Med14 domain of Kingdom Metazoa
Unable to open file!