Description | Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MLNVMRNAAMAISANNMIDSGTKQVDYDVCRFDKSFEEFFSLIDQLEVHLRTSIECLNQSGQSAKYLPVPVTPNKTDNSMTYPQYIELVKGQIAYAKEIHGALTEASQRMCDS |
Length | 113 |
Position | Tail |
Organism | Orchesella cincta (Springtail) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola> Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.309 |
Instability index | 59.05 |
Isoelectric point | 5.02 |
Molecular weight | 12717.31 |
Publications | PubMed=27289101 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP09511 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AKYLPVPVT 2) MTYPQYIELVKGQIA | 64 80 | 72 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab