| Description | Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MLNVMRNAAMAISANNMIDSGTKQVDYDVCRFDKSFEEFFSLIDQLEVHLRTSIECLNQSGQSAKYLPVPVTPNKTDNSMTYPQYIELVKGQIAYAKEIHGALTEASQRMCDS |
| Length | 113 |
| Position | Tail |
| Organism | Orchesella cincta (Springtail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola> Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.309 |
| Instability index | 59.05 |
| Isoelectric point | 5.02 |
| Molecular weight | 12717.31 |
| Publications | PubMed=27289101 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP09511 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) AKYLPVPVT 2) MTYPQYIELVKGQIA | 64 80 | 72 94 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab