<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09505
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MTNILVHGSGAFLDRTKMATPRAETEDQLKLRFQVELEFVQCLANPNYLNFLAQRDYFKVPEIINYLKYLQYWKEPEYARYLKYPMCLYFLDLLQYPEFRKELANAKCAKFIEDQQLLHWQHYIRKRSKLIPPNSNQGSSSNTGSSNVAISDSGNNSTSNTVSTTSTNNAMQVMSQQNSNMK |
| Length | 182 |
| Position | Middle |
| Organism | Orchesella cincta (Springtail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola>
Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.604 |
| Instability index | 39.67 |
| Isoelectric point | 8.90 |
| Molecular weight | 21129.72 |
| Publications | PubMed=27289101
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09505
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.45| 16| 16| 128| 143| 1
---------------------------------------------------------------------------
128- 143 (28.48/18.33) SKLIPPNSNQGSSSNT
146- 161 (26.98/17.03) SNVAISDSGNNSTSNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.02| 19| 22| 57| 78| 2
---------------------------------------------------------------------------
57- 78 (32.51/27.83) YFKVPEIINYLKYLQYwkePEY
81- 99 (38.51/23.76) YLKYPMCLYFLDLLQY...PEF
---------------------------------------------------------------------------
|