<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09504
| Description |
Mediator of RNA polymerase II transcription subunit 27 |
| Sequence | MPAYLRNVEDSYIVAPEAVNSAIMGFSNSFNDIDIQITRPLGSNAVLMYVVLGRTLRSVVILKGWLIEWVVIREGYDERRRNFKPMSESKIQSFQKVTDNANAAMLHFCAPTHPELSVKSFLTWLHSYITLFTQPCKKCGLHLSNNLPPTWRDLRTLDPYHEECKP |
| Length | 166 |
| Position | Tail |
| Organism | Orchesella cincta (Springtail) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Collembola>
Entomobryomorpha> Entomobryoidea> Orchesellidae> Orchesellinae> Orchesella.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.181 |
| Instability index | 49.64 |
| Isoelectric point | 8.36 |
| Molecular weight | 19071.82 |
| Publications | PubMed=27289101
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09504
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.24| 15| 25| 123| 137| 1
---------------------------------------------------------------------------
123- 137 (29.57/20.42) TWLH.SYITLFTQPCK
150- 165 (25.67/16.94) TWRDlRTLDPYHEECK
---------------------------------------------------------------------------
|