<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09479
Description |
Uncharacterized protein |
Sequence | MNSGIDADFRDQTSRERTKVEDLFDYDGCKVGRGTYGVVYKAKKKDGSNGEYALKLIEGTGISMSAVREISLLRELKHRNVINLQKVFLSSVDRRVWLLLDYAEYDLWHIIKHHRTAKGSRKAVETPKSMVKSLLYQIIDGIFYLHSNWVLHRDLKPANILVMGEGPERGCVKIADMGFARLFNCPLKPLADLDPVR |
Length | 197 |
Position | Kinase |
Organism | Ramazzottius varieornatus (Water bear) (Tardigrade) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Tardigrada> Eutardigrada> Parachela>
Hypsibioidea> Ramazzottiidae> Ramazzottius.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.324 |
Instability index | 28.51 |
Isoelectric point | 9.28 |
Molecular weight | 22481.78 |
Publications | PubMed=27649274
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09479
No repeats found
No repeats found
|