<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09479
| Description |
Uncharacterized protein |
| Sequence | MNSGIDADFRDQTSRERTKVEDLFDYDGCKVGRGTYGVVYKAKKKDGSNGEYALKLIEGTGISMSAVREISLLRELKHRNVINLQKVFLSSVDRRVWLLLDYAEYDLWHIIKHHRTAKGSRKAVETPKSMVKSLLYQIIDGIFYLHSNWVLHRDLKPANILVMGEGPERGCVKIADMGFARLFNCPLKPLADLDPVR |
| Length | 197 |
| Position | Kinase |
| Organism | Ramazzottius varieornatus (Water bear) (Tardigrade) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Tardigrada> Eutardigrada> Parachela>
Hypsibioidea> Ramazzottiidae> Ramazzottius.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.324 |
| Instability index | 28.51 |
| Isoelectric point | 9.28 |
| Molecular weight | 22481.78 |
| Publications | PubMed=27649274
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09479
No repeats found
No repeats found
|