<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09477
| Description |
Uncharacterized protein |
| Sequence | MAGRSAPVPTTKADSMIKALGKKQKDDVQSILSNMMEILKLMKVDDDRSAPVRAQTAEQDHLEMSVRASNMIRCAESLMNLNEELKKLFFLNDFPFISQTVQRAREKATAETKEIQKRMMNVYTEMQTELYDLEEEYGSCWYLKDNNPFTPAPSR |
| Length | 155 |
| Position | Head |
| Organism | Ramazzottius varieornatus (Water bear) (Tardigrade) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Tardigrada> Eutardigrada> Parachela>
Hypsibioidea> Ramazzottiidae> Ramazzottius.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.638 |
| Instability index | 56.25 |
| Isoelectric point | 5.56 |
| Molecular weight | 17834.27 |
| Publications | PubMed=27649274
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09477
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.01| 11| 43| 4| 14| 1
---------------------------------------------------------------------------
4- 14 (20.43/14.03) RSAPVPTTKAD
48- 58 (19.58/13.22) RSAPVRAQTAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.77| 16| 49| 78| 93| 3
---------------------------------------------------------------------------
78- 93 (27.08/16.38) LMNLNEELKKLFFLND
130- 145 (29.69/18.49) LYDLEEEYGSCWYLKD
---------------------------------------------------------------------------
|