| Description | Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MESSLRQQVHEHITEYSDLVKKYFASLSAVAENASIEKANRPEEIIKQMAFVDQKLQQAVEHIENHQARQQQIASVQDEIQQHNIALLEIIQKLGTVRDELDLSLAEAKIELKAIKYASDSNVQFTDVLSYASKLSKYTSAPPNFDSGNRDIRVDFEKPYPDEERMRRGLLYWQNTPQHHKEDQFEHSDSESSADEEMVDVTNARPNEDSGGDPFWILDLNPDMQP |
| Length | 226 |
| Position | Middle |
| Organism | Choanephora cucurbitarum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina> Mucoromycetes> Mucorales> Mucorineae> Choanephoraceae> Choanephoroideae> Choanephora. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.809 |
| Instability index | 52.08 |
| Isoelectric point | 4.72 |
| Molecular weight | 25971.36 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09454
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.23| 21| 44| 44| 64| 2
---------------------------------------------------------------------------
44- 64 (36.98/22.39) EIIKQMAFV.DQ.KLQQAVEHIE
89- 111 (23.26/12.06) EIIQKLGTVrDElDLSLAEAKIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.64| 10| 60| 139| 148| 3
---------------------------------------------------------------------------
139- 148 (21.20/13.64) TSAPPNFDSG
202- 211 (20.44/12.93) TNARPNEDSG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ADEEMVDVTNARPNEDSGGDPFWILDLNPDMQP 2) QFEHSD | 194 184 | 226 189 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab