<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09449
Description |
Mediator of RNA polymerase II transcription subunit 14 (Fragment) |
Sequence | MHPTMTTSNGTSHLDEPSKDKEKIVLPVEMASMVPLRTLIAKLVHKSYADLLTLTDTLPSMSDVEKKRRILTYSLSVRKQFLKLLVLIKWAENAEDIQMCQNIMAFLANQNKIFQDTVDYLHNIHSKLPAARLRNFDIPTAVDVLTTGTYQRMPTKIKDMMAPVPLSDQEVLETFQNMNDVIRMRMITTEVLPSPMQTYRIENGRIYFTIQNEFEVALTLMGHSHDRRWWIVSLDMLVQATSTGGAAEDVDITLNETQKQHLRVNAQKQLVPPPSMESNSLFFPLVNMYDYLHLCCLNMQLEVLYIQAAMLAKTRWINQLKVQMNPDRTKLTLIYWRGGSHASRWASRSNSDKSTTIEISVNDQEDPEEDYQMAVRDDWHGVIQKAGIGASIHLSELPVQDRSRVLSLLKYPKTTLSVLWDGYELKDHGLDPSDLNLERLVLQTTHDHGACMIDKFRSLLLSQRAFLEENGLFLDTTSTSQLVVRYRHAKYISIDTDTRTGRIKAFEADDGCHEGDFKLRGLEDRLNNDPENIARHLLWLRSEVVVREVIALAKQLNLQPYHPSQMNLRPEDIQKLFGDLVPDGVKEVSYPSHCVFLQFSQFEDWYFCMATVKNQFKSWLCCINKTYDATGLYQTIVDLAHLNSDQLWSGQFKQTSPTMERETLKREIKEEDEKEEGVLPGLKKRRTSRFLLPTKERDEEEDGGEPIKKEEDEKVDRLSIDLRYLAKLDSLCQAYIINRKIESQLQSYKGSLKYHTRPLLKTINRMETQVRNHPAAEKMEVICVSQ |
Length | 786 |
Position | Tail |
Organism | Choanephora cucurbitarum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mucoromycotina>
Mucoromycetes> Mucorales> Mucorineae> Choanephoraceae> Choanephoroideae>
Choanephora.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.448 |
Instability index | 45.52 |
Isoelectric point | 6.13 |
Molecular weight | 90746.94 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU365082
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09449
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 152.10| 54| 267| 95| 183| 1
---------------------------------------------------------------------------
124- 183 (86.94/127.77) IH.SKLPAA.RLRNFDI...P.TAVDVLTTGtYQrmptkIKDM.MAPVPLS.DQEVLETFQN....MNDVIR
392- 457 (65.16/32.35) IHlSELPVQdRSRVLSLlkyPkTTLSVLWDG.YE.....LKDHgLDPSDLNlERLVLQTTHDhgacMIDKFR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.75| 14| 165| 109| 122| 2
---------------------------------------------------------------------------
109- 122 (27.09/16.71) NQNKIFQDTV...DYLH
277- 293 (21.66/12.08) ESNSLFFPLVnmyDYLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.42| 18| 39| 657| 674| 5
---------------------------------------------------------------------------
657- 674 (33.40/21.38) PTMER...ETLKREI.KEEDEK
693- 714 (25.02/14.31) PTKERdeeEDGGEPIkKEEDEK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.05| 28| 325| 294| 321| 6
---------------------------------------------------------------------------
294- 321 (51.67/37.78) LCCLNMQLEV..LY...IQAAMLAKTR.WINQLK
620- 653 (39.37/26.99) LCCINKTYDAtgLYqtiVDLAHLNSDQlWSGQFK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.19| 12| 114| 218| 229| 7
---------------------------------------------------------------------------
218- 229 (26.64/18.93) LTLM...GHSHDRRW
331- 345 (19.55/11.93) LTLIywrGGSHASRW
---------------------------------------------------------------------------
|