<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09443

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMANPHGRSVMRLRGGFLLGPAPISSEWGSGWEHHARNRPLVHCHLQVQLTHSSSASISVARLTIYPILRPTYYLPLYLSLPVPPGTPIVLLPHGAPAFYLSTYAGPASALTSQFEEALVGLGVGDWARTSPSNAQHGDTAFPASASAIKDTPTYVIAWLAVQNKQGEDKGMPVVWPARLCISFHPSSPSVHARTPLAYIPELPAQLQSSPPPPAPTIPQSLSLASIGPSGSDAASATSPAQSIQASLPDSERLSSSMLRRPNTLSSSPTSDSLRAFRTLSLAQRPYARNIRKVAAEVSGYVDFVAKEREKERERLRRERQEQDATNARARTASITEPTAEMDVEPAPESDESTSALFSPPEISVDLPSSDDSMQVRTEPPAGAAANLPPILPSSSVPSTPDLGSSNMDGFDPFNGFDNSWSQQSNGFMDMNMDYDIGFNMNISSMDDGRGGGNTAGNFDLDDGFGVFTEDDFDFFDGPAAQRAAAAPVLASTVPVDARTPFPPAATPVPLVFALPLSGEAMTMSGPGPPSVGLKVDSPWTTQLGEGFTPRAIETLPLPDGVPPAPTCSLHPRRRHLHPIRRPQRHACSSLTMRKLIGVKRKSFDQGVREVRKTPTWLREDEEWEGSSAREVDINDEVMSEADSEDEEPWVDDDDASSIARPSTPPPSYLPLGPTLLQTHFHHSHLLPLSAPLRPPGAAVDNSPAGAAPMSVPTPVSPAAVLGAASEKSKSLEAAAQILIHEVVENSIWSDAWRANAVLSHSSSRPPIKVWQSDIKQVAAFLGSTEMVQSPVDLQTLSTPLDLVLAESSDSPVASSALIKMLDSPVLAVGKADSVVQVSPTALRFWEKLGLGPRPGRKDITAFIFFEHVGDDREAEVEEWLGKVSATYAAKNYGLHSAGISSQCTKAGLVPVRFDIFRKTLVNFVSTLPSLECNLVFYIVTPAYIITSTSTVLRQLFSAVKRIHKAHPDTQILFHFVPESLVTGILTNPQSSLDGLEPFVDSVYDRILQPVERAMSRKLFTHSARTRAYFHAPAYTLARSALTQSQGSGSEARVLFVLEPHPSSLDVVDRYALLHVGYTVTPCGRWVLAACVDARGEAHELRAWLTPGDGVESFVVAQVWTLLRDFAKRADLEWRLVISKLGLMGSAELDMWISHLESAVLMSAEIPPMHVTLLAVDHDNPWTFLAPDAGTTTNIVKRTSASTSSSSRTSARMPSGAAFADMSYATYALYPSSELTSFPTPSSTSPNGPGASVNTAPGSADLSFVPDSEEEEPIGQSQQMQTPSMRAQRASTLVCVPAGTDYTSISTVHLYQLYAVRSLRSTFGKRPTASQAGTSSAVGEVPEQSRDMKDDDRETLHDITRNFHDLAVLARARWKLRADPALPFHLAALDVMRTTLSAEGD
Length1400
PositionKinase
OrganismGrifola frondosa (Maitake) (Polyporus frondosus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Grifolaceae> Grifola.
Aromaticity0.07
Grand average of hydropathy-0.219
Instability index57.30
Isoelectric point5.51
Molecular weight151004.23
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09443
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.85|      19|      19|     349|     367|       1
---------------------------------------------------------------------------
  366-  386 (23.75/ 7.32)	LPsSDDSMQVRTEPPAgAAA.N
  686-  701 (22.94/ 6.77)	LP.L....SAPLRPPG.AAVdN
  702-  720 (24.16/ 7.60)	SPaGAAPMSVPT.PVS.PAA.V
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     205.37|      58|      82|    1213|    1270|       2
---------------------------------------------------------------------------
  225-  252 (24.87/ 6.67)	...............................SIGPSGSDAASATSP.AQSIQASLPDSER.
 1213- 1270 (102.25/54.30)	PSGAAFADMSYA.TYALYPSSEL.TSFPTPSSTSPNGPGASVNTAP.GSADLSFVPDSEEE
 1296- 1353 (78.25/39.52)	PAGTDYTSISTVhLYQLYAVRSLrSTFGKRPTASQAGTSSAVGEVPeQSRDMK...DDDRE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.97|      18|      19|     788|     805|       3
---------------------------------------------------------------------------
  788-  805 (31.26/16.90)	QSPVDLQTLSTPLD.LVLA
  809-  827 (26.71/13.36)	DSPVASSALIKMLDsPVLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.63|      19|      19|     606|     624|       4
---------------------------------------------------------------------------
  605-  623 (37.26/23.67)	QG..VREVRKTPTWLRE....DEE.W
  624-  649 (20.37/ 9.67)	EGssAREVDINDEVMSEadseDEEpW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.11|      10|      19|     840|     849|       5
---------------------------------------------------------------------------
  840-  849 (19.58/11.44)	TALRFWEKLG
  860-  869 (19.52/11.39)	TAFIFFEHVG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     160.06|      37|     347|     185|     223|       6
---------------------------------------------------------------------------
   53-   93 (32.51/11.57)	.SSASISvARLtiypilrPTYY...LPLYLSLPVPPGTPIVllPH..
  142-  179 (58.75/25.11)	PASASAI.KDT.......PTYVIAWLAVQNKQGEDKGMPVV.wPARL
  185-  221 (68.80/36.07)	PSSPSVH.ART.......PLAYIPELPAQLQSSPPPPAPTI..PQSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.07|      21|     618|     520|     540|       7
---------------------------------------------------------------------------
  520-  540 (43.89/24.81)	AMTMSGPGPP.SVGL.KV..DSPWT
 1158- 1182 (28.18/12.97)	AVLMSAEIPPmHVTLlAVdhDNPWT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.72|      17|      19|     549|     567|      10
---------------------------------------------------------------------------
  549-  567 (28.33/20.24)	PRAIETLPLPDgvPPAPTC
  571-  587 (34.39/18.32)	PRRRHLHPIRR..PQRHAC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.64|      13|      19|     478|     494|      11
---------------------------------------------------------------------------
  478-  494 (17.91/17.73)	PaaqrAAAAPV.LASTVP
  502-  515 (20.73/ 9.42)	P....PAATPVpLVFALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.41|      19|     618|     739|     758|      15
---------------------------------------------------------------------------
  728-  747 (24.09/ 7.84)	SKSLEAAAqILIHEVVENSI
  749-  767 (33.33/21.23)	SDAWRANA.VLSHSSSRPPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.49|      15|      20|     407|     421|      17
---------------------------------------------------------------------------
  407-  421 (31.92/21.66)	MD.GFDPFNGFDNSWS
  428-  443 (25.57/15.85)	MDmNMDYDIGFNMNIS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.85|      13|      20|     972|     985|      18
---------------------------------------------------------------------------
  972-  985 (18.37/16.80)	LFHFVpESLVTGIL
  995- 1007 (23.48/14.88)	LEPFV.DSVYDRIL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09443 with Med13 domain of Kingdom Fungi
Unable to open file!