<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09437

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMEPAANGLIANGASSSTSHTQAPDSTPYTNGFHEPTQEELERELPIVNDGQVPLGELISRMAQSIYAELSELAETMPNMSDSARKRTLADWVVKTKRQVVKLYAVVKWARDADVVQKAMNVTAFLMDQNEQFEQAMNGLKFARDGLDPARLRNHDLLTSLDVLTTHSYRRLPTCIKKVVIPPTPLTDEEVAKTLSDVESAMRFRLRISEIMPIEMSKYRIADGRVFFTAPKLFEMSLCLRGVQKDDGWFFVNVEFLFTVGGDRTGVQGDTRCCLLKRHITDEADARLAFYLPIPPDQAPPPEVELPPRPQLPEGVTDAPLVRVFNFLQIMSLSYQLEILWYQAERMRSLGWADYMRTEMTKNRQTLTISYWIRKPPPQVPGKPTPQAKHKLPPLGGKLIISIERSKLDGRRPSDEVESLRFEVKWEPEKGALGVVIPVEDARLPQGELLINPDDLDLESLLYKVIRKHTEAILKVFQAQLQHGPTTRNVFSGTGEVVLVHEPDGAHALRTHLCADEVVIVTIDPRTGRLNLRDTGDLAAAGRGPRFTVISDRLNDSPAILPDALLRLKFSTITDLAEQKANYLGLQSYRHRNFSNEEIQKLGPTRRGMLYIQLANFPKHYLVLVITDEEFRYALISVEVQKDTMYNNVIMEDIGWLNVRRIHGENFAVAPAPDAGNPRAGEKRKRDPGDEAGRGAAAPDSYPCSFRLETQVLRELYAYCCARVAYTKHQRRPDARACTHPVFSGAFHPGAMRAVLRYPVGCAGGGGSDAEYPLSSLLNWWSGERAKVVTCVKLKYVQQPVGAKAGSSSVIRPSKRIIYDTREAVVSFLSDDVDKCVDEFLEEWARVSKMVVIAREGHRCRGEAVDGRAATVVRPADGRVRVRCGLRRLHHLHGPALHDGRLVPLALLARVESATALSDVPRHNPHDDVEPFMRDLCGTRMAPSLHKLVGLLRDTLPVVAELEDIRTNSARMGGSVDTFAKAAGWFRILYGDLRHALDFRLMTGSRIVILDGSHTLFDVDDNSELRRSHAGKTAERPHRRDGTLVLQPIPSFPAIVTDALSTAAPRTKGGHFASIDVGVICDVSVVQIIGRTLYEKVLERLNNPVSIS
Length1107
PositionTail
OrganismGrifola frondosa (Maitake) (Polyporus frondosus)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Polyporales> Grifolaceae> Grifola.
Aromaticity0.07
Grand average of hydropathy-0.286
Instability index39.85
Isoelectric point8.19
Molecular weight123555.14
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09437
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.98|      20|     141|     885|     904|       1
---------------------------------------------------------------------------
  885-  904 (38.88/23.64)	LRRLH...HLHGPALHDGRLV..PL
 1024- 1048 (28.10/14.87)	LRRSHagkTAERPHRRDGTLVlqPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.34|      20|     140|     200|     219|       2
---------------------------------------------------------------------------
  200-  219 (35.91/26.48)	AMRFR.LRISEIMPIEMSKYR
  343-  363 (31.42/22.19)	AERMRsLGWADYMRTEMTKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.00|      17|      32|     146|     162|       3
---------------------------------------------------------------------------
  144-  160 (28.73/15.72)	DGL.................DPARLRNHDLLTSL
  161-  194 (18.27/ 7.24)	DVLtthsyrrlptcikkvviPPTPLTDEEVAKTL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     153.15|      53|     117|     483|     558|       4
---------------------------------------------------------------------------
  483-  543 (80.39/98.02)	GPTTRnvfsGTGEVVLVHEPdgAHALRTHLCADE..VVIVTI......................................DPRTGRLNLRDTGDlaAAGRG
  602-  694 (72.76/39.66)	GPTRR....GMLYIQLANFP..KHYLVLVITDEEfrYALISVevqkdtmynnvimedigwlnvrrihgenfavapapdagNPRAGEKRKRDPGD..EAGRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.03|      22|      22|     222|     243|       6
---------------------------------------------------------------------------
  222-  243 (40.49/24.20)	DGRVFFTAPKLFEMSLCLRGVQ
  246-  267 (41.54/25.01)	DGWFFVNVEFLFTVGGDRTGVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.09|      11|      15|      54|      67|       7
---------------------------------------------------------------------------
   54-   64 (18.29/20.94)	LGELISRMAQS
   72-   82 (19.80/ 9.14)	LAETMPNMSDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      96.45|      23|     140|     288|     310|       8
---------------------------------------------------------------------------
  288-  310 (45.91/26.09)	AFYLPIPPDQAPPPEVELPPRPQ
  412-  428 (20.02/ 6.99)	......PSDEVESLRFEVKWEPE
  431-  452 (30.52/14.74)	ALGVVIPVEDARLPQGELLINP.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09437 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MEPAANGLIANGASSSTSHTQAPDSTPYTNGFHEPTQEELERELPI
1
46










Molecular Recognition Features






MoRF SequenceStartStop




NANANA