Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MPLTGLFVVAVGPGQSSPSAALISHISRSFPAEPLPTFYLDHRLFIDTSSLLPSSNASLRKSTSILTISHTPTTTYVATTSPASPSKEQSAVAPSPTLITIPSTSADSFTQLIGTKLQPLWTHRQSLIIENGTALSFLDGEWIIRIGDLKTPPRANQAGSNLRGMLIEVSHMEDDNHVQMQGPNDVQKDVLDVDKEDEALLRGFLDSVTDGSGVPSITSSDSNRFLIRRTKVREKDKGAVSPAADFELARVYLDILRGSRG |
Length | 261 |
Position | Head |
Organism | Cladophialophora carrionii |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.191 |
Instability index | 53.33 |
Isoelectric point | 5.86 |
Molecular weight | 28164.45 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09427 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 119.54| 31| 68| 82| 114| 1 --------------------------------------------------------------------------- 82- 114 (46.24/30.35) PasPSKEQSAVAPSPTLITIPSTSADSFTQLIG 116- 137 (23.21/ 8.80) .....KLQPLWTHRQSLI.IENGTALSF..... 152- 182 (50.10/27.25) P..PRANQAGSNLRGMLIEVSHMEDDNHVQMQG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LDILR 2) RFLIRR | 253 224 | 257 229 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab