<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09422

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMTSIPLAEPRPPPQLPRPPGLSRPPARRSTSNVFSPLDRRPSGLQRQMSDIGDDRPAKRRKMEGEGQLLEQASSHNTITPVLTQPADSEGGDRTVQLRWVKPSAIRLRAGNSLRKDEESGEGEDDVPELPPRPWRAIQASHAMEEPKPTHRSRVNIPVPNTPDSIELPSAVPHFVPRKPAGFFPWTGKHAEDILSDTNVKTGYFDKPPTPTEKELNTARVPLYNAFKHKSGVDSLSVLFSLVLDQKSLHGTTSSVSTFKPPPRVTLTEAKRKSWIADLANADVPLRRLSRTIPQGIRGQALLDQCLQSDVPLSRAIWFAKCVCANEIRTLKRKGTTPTVAVGTETKWLREWTVNVEQFLEAHLARSSLPDWKSNIQYALRLTTRLYLENLLDRDHYLDWILRSLASADVGHTPFWLMVTHIYKQDLSQYRRKGSRLVEVLINKFRSLDKAQEPTMAPLRQKLRAAIRELLFARSALFLMPDKWPERMEIIRACLDPTLPPERQLFEGLNRINKRAMGYNKADISSIRAPDQAIVDILDAARVPYNLAALEDTLKTACSDFALLMQTCLEWSCTRFRCSRTRIYLITRLVKRWQREGLDVDTALLSFLSAYRERRTTADAENLRHLIAQLSRSDCFNISKYLQWLMVRGLPKHGMVDIDPYSTSGSAAGTWQEEDPEATHFLLDLSLDKADDHVVNLRRAMLERAGFDLNSEEAAFRQCIRFIEQGLAGPNSASNSPSPSVTEPAFDSLPWTLRTRVSKWLRARALEGAKAEETGPALPGSRVLNEGQFFLIRHILESMDDEAVLADVVGILSASKNDDLVASLVATIHFHADAFSSIGALELLQKQMCQVYMTWRPAKPTMPLLTSTLLDLCTAFPSKTPAIKLLQQDLVRGDRGRAVAACSPYSDGIAESLQQAGATFVEDFEAILQSETNMNEQTMNGLFSVLVDRIEKQQKFGDDPQTTLSFCQLLSRLRLCRKGQGDRLIQKWMSRVLPRLDSKWGPLLLRSLVSTGCLSFNALLEAVVTSKHGTRRNVAFASLLYQMLGSTKGTAPDWAAYQTRTRWYEYVQREPKAALEVLCEAGLQGFSPKFDALLLSLLVNGSTSSSFVLSGAVRQWFLKTLSRSLNCRDGELTGTDLRALFQTMNIFSHPYVQLRVRSTPESTAEKGSGVNHDELADVLHTSLQNTMQISPRSSGKGQDRRFAQFLQTVGPEVASSIRHKVENEFLEASPKLPLGKATSPLAAAFPGEVQQLGSIVERAFQVCRKDTVPSAGFLSQLIDRLSQFFKSLAYASVAPSTPVTTGHPAIPGLSGPTTATSSPQMVPAPATPTMSASENGPSACSVPCLSYLKYMLQMVCLQRPALILAGVSGPNSKQGQSEQVQLLVRLASIATHPAMAAASKQPGSEERQALAKDVILSMFDIIATIVDEVSDEVNMMCAKLLKDKLQDGRVRYLFGSINMLGSVQVQDMGQGLQLTKEGKGVIGEWRPRMWEVLNNGSGKETETSLGLGLFGARYG
Length1514
PositionKinase
OrganismCladophialophora carrionii
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae> Cladophialophora.
Aromaticity0.07
Grand average of hydropathy-0.290
Instability index50.36
Isoelectric point9.00
Molecular weight167959.40
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	RuleBase:RU364147
ECO:0000256	

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats
>MDP09422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.69|      23|      26|    1294|    1318|       1
---------------------------------------------------------------------------
  738-  757 (21.47/ 7.83)	..PSVT..EPAFDSL......PwTLRTRVS
 1294- 1318 (41.67/30.23)	PSTPVTtgHPAIPGLS....GP.TTATSSP
 1322- 1342 (29.54/13.95)	PA.......PATPTMSasenGP..SACSVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.14|      14|      26|     358|     371|       2
---------------------------------------------------------------------------
  358-  371 (26.78/14.68)	FLEAHLARSSLPDW
  386-  399 (27.36/15.15)	YLENLLDRDHYLDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.20|      14|      26|    1371|    1384|       3
---------------------------------------------------------------------------
 1371- 1384 (23.85/14.66)	SKQGQSEQVQLLVR
 1398- 1411 (24.36/15.14)	SKQPGSEERQALAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.08|      25|      26|     453|     477|       4
---------------------------------------------------------------------------
  453-  477 (41.70/25.28)	PTMAPLRQK.LRAAIRELLFARSALF
  480-  505 (44.38/27.44)	PDKWPERMEiIRACLDPTLPPERQLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.83|      15|      21|    1015|    1029|       7
---------------------------------------------------------------------------
 1015- 1029 (25.37/14.45)	FNALLEAVVTSKHGT
 1035- 1049 (26.46/15.36)	FASLLYQMLGSTKGT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.90|      23|      74|      50|      89|       8
---------------------------------------------------------------------------
   20-   42 (42.45/20.43)	GLSRPPARR............STSNVFSPLDRRPS
   52-   86 (33.45/38.08)	GDDRPAKRRkmegegqlleqaSSHNTITPVLTQPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.73|      14|      21|     934|     954|       9
---------------------------------------------------------------------------
  934-  949 (19.24/28.20)	NEQTmnGL.FSVLVDRI
  958-  972 (21.49/ 6.89)	DPQT..TLsFCQLLSRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.11|      11|      21|     847|     857|      10
---------------------------------------------------------------------------
  847-  857 (23.65/16.34)	MCQVYMTWRPA
  871-  881 (20.46/12.94)	LCTAFPSKTPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.15|      17|      74|     621|     637|      12
---------------------------------------------------------------------------
  621-  637 (29.16/14.76)	NLRHL.IAQLSRSDCFNI
  640-  657 (26.98/13.17)	YLQWLmVRGLPKHGMVDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.93|      18|      28|    1148|    1175|      13
---------------------------------------------------------------------------
 1148- 1168 (27.59/33.63)	HPYVQLRVRSTPESTaekGSG
 1179- 1196 (32.34/13.16)	HTSLQNTMQISPRSS...GKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.47|      27|      28|     106|     133|      14
---------------------------------------------------------------------------
  106-  133 (42.62/28.47)	R.LRAGNSLRKDEESGEGEDDVPeLPPRP
  135-  162 (38.86/21.40)	RaIQASHAMEEPKPTHRSRVNIP.VPNTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.94|      13|      28|    1235|    1251|      15
---------------------------------------------------------------------------
 1235- 1251 (13.31/21.59)	KATSPlAAAFpgeVQQL
 1264- 1276 (23.63/14.36)	KDTVP.SAGF...LSQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.56|      20|      28|    1463|    1482|      17
---------------------------------------------------------------------------
 1463- 1482 (34.99/22.78)	QVQDMGQGLQL.TKEGKGVIG
 1490- 1510 (29.58/18.06)	EVLNNGSGKETeTSLGLGLFG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09422 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IRLRAGNSLRKDEESGEGEDDVPELPPRPWRAIQASHAMEEPKPTHRSRVNIPVPNTPDSIELPSAV
2) MTSIPLAEPRPPPQLPRPPGLSRPPARRSTSNVFSPLDRRPSGLQRQMSDIGDDRPAKRRKMEGEGQLLEQASSHNTITPVLTQPADSEGGDRTVQLRWVKP
3) TGHPAIPGLSGPTTATSSPQMVPAPATPTMSAS
105
1
1300
171
102
1332










Molecular Recognition Features






MoRF SequenceStartStop




NANANA