<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09413
| Description |
Serine/threonine-protein kinase ssn3 |
| Sequence | MSIPGMSRPGTSLNIAQQLRKTTQLAALEGLLAGLQLREATQLTGVIDGLRGLDKKQPGNSYTSKVKIGQKYNIIGFISSGTYGRVYKAVEKNPKGDPSSPVGTSPPKELYAIKKFKPEKEGDNVQYTGLSQSAIREMSLCTELTHPNLVHLAEIILEDKCVFMVFEYCEHDLLQIIHHHTQPTRRAIPASMIKSILFQLLNGLFYLHQNWVIHRDLKPANIMVTSSGHVRIGDLGLARLFHKPLSSLYSGDKVVVTIWYRSPDLLLGARHYTPSIDLWAVGCIFAELLSLRPIFKGEETKMDSKKTVPFQRNQMGKIVEILGMPRRENWKGLVDMPEYPQLQSLIVSRGGMPGGLYPSSNSMNRGLGNNGSGLEAWYNNCLKHASYPSDKSPGQRGFQLLSDLFEYDPEQRLTAEQALHHDYFKNADEGPHHGKIWVSNNCFEGLNEVYPHRRVSTETNDIGTGSLPGTKRGGLPDDTLLPAAKRR |
| Length | 487 |
| Position | Kinase |
| Organism | Cladophialophora carrionii |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Chaetothyriomycetidae> Chaetothyriales> Herpotrichiellaceae>
Cladophialophora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.403 |
| Instability index | 44.88 |
| Isoelectric point | 9.11 |
| Molecular weight | 54312.62 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP09413
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.80| 13| 15| 336| 350| 2
---------------------------------------------------------------------------
336- 350 (21.49/17.15) MP..EYPQLQSLivSRG
352- 366 (22.31/11.46) MPggLYPSSNSM..NRG
---------------------------------------------------------------------------
|