<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09410

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMTEFLGDSPPRPTTVIPGQWIIQLPSPDTQVYIHGYKRARLDNEAGPSNYELEDVILDPFERAWRQINDSPNDQMFSVNNLERPCAIISQTPVDEKQEKVLWVFITSNDQIVPLDGLEEITPHHQPISITQLVTCPKHGHDPSCLDSQSSSDNKTTCIVSLDTSQDVARHLDLLASALAERMAWKKGTRLILDSKPHLQSSLKASIRPISSLKLLLSVRPSTHPIATSSITLPPLRLLPLNLPALHVSSSSLTSTQHRHLASTFDSALGHTWKHGRSESRTLAQITGETYSDWSIYWVPLSTPSSSKGKLTPRQLVERWKNSQGLLTIWPTHLAQPYFATRYPKGKKSVVRPLQPKSSDLLDISTGVFDFLSSYKEPDPPLDHEDDEDEEADENIDVESTVITAEPEPEPIGNDVGGSEKSDIDDLFSEHSNSITNSPAPTIPLPIPPPDPILDQNGLEPVSISVNEDDTMNFINMDMNMDNENRQLSRNASNTNGLDNTQKEEMVTEDDFAFFDSPTDQIANEGELNESTQENHVAEDDRMNLDLNLPSVLEVQPDLTLNVEQDLLQIQIPTQDQTLPLEAHNLPTSSSYLNPTALVDDEDIHPEESPHPITADVTALPRQPPSPVPLPFQRSTNDLIPLSFSPLPLLPISESPFPYSLPTPAPTPSSLNWDLVERLQPPKTSVSTYANDWKMDEEISEIDEEEMYTGPPTPESAYTSSDEDEGNTFINDRKRLSESNGTEIEFSGVRCIASEWVYLAYEFGYGVDGDRLKEFMRDWNPSWIRDMTVLPPTPPAEVADRSWNKGLDLKRFVKDMIGNRALRQMLDYSDNTTSTIYSDMMGLSILDGGITLSDLSKESKQRFLPQPQISAGYHNYTINLSIPSLQYWSELGLQPHGGYKDVEAIILCEDTDEAREKGKEIGIGMKRTWEELHLGSHHIAEIGGATQGVISVPTSVFSEAVANLMNQSPTHTILYILLPPSTTISSSLLNSLFNISLSPSSSTVIQLVPQCALNPSCYREIAFEVYNRISEPVKEINARSISDPYGLSQHSTSDDHLTRHAFTLARDGNPTPEFSMSWPLKSYDVLNIHRSIHAVYNFDEDLGVMMGFIVDDLGEMFDWMIWGDQIDVHVDKIWKWIRGKSDDWLINWRLNVMRVGKMYSDELQAWRKVLSNSQASITLLTTSYDLNGGESDVHDMDDIPRPKGFANIPLTTLNDPNSQIIDLSLSAQLTTLPSVKLPIGLEVPNRKDNEEVEIVYPVSSFILTHPSSSHEKYRSAVYNILHRNHSHGKKNLDTGVEDELGEEIYRIGCLIDSRWGINGGLAGLIRVGIKGLSSLAQGGGD
Length1340
PositionKinase
OrganismKwoniella mangroviensis CBS 10435
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes> Tremellales> Cryptococcaceae> Kwoniella.
Aromaticity0.07
Grand average of hydropathy-0.459
Instability index48.93
Isoelectric point4.66
Molecular weight149548.38
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



	RuleBase:RU364134

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats
>MDP09410
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.24|      12|      15|     640|     652|       1
---------------------------------------------------------------------------
  640-  652 (20.38/12.85)	PLSF.SPLPlLPIS
  657-  669 (19.87/ 7.74)	PYSLpTPAP.TPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.34|      19|      21|     212|     231|       2
---------------------------------------------------------------------------
  212-  231 (27.20/20.27)	LKLLLSVRPSTHpIATSSIT
  235-  253 (32.15/18.55)	LRLLPLNLPALH.VSSSSLT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     431.85|     167|     342|     544|     885|       3
---------------------------------------------------------------------------
  372-  530 (103.32/20.52)	SSYKEPDPPLDHEDdedeeadenidvestvITAEPEPEPIGNDVGGseksdiddlfsehsnsitnspaptipLPIPPPDPIldqnGLePVSISVNE...................................D..DTMN........FINmDMNMDNENRQLSrnasntngldntqKEEMVT...EDDFAFFDSPTDQ....IANEGELNES................................................................................
  589-  818 (242.21/319.99)	SSYLNPTALVDDED................IHPEESPHPITADVTA..........................LPRQPPSPV....PL.PFQRSTNDliplsfsplpllpisespfpyslptpaptpsslnwDlvERLQppktsvstYAN.DWKMDEEISEID.............EEEMYTgppTPESAYTSSDEDEgntfINDRKRLSESNGTEIEFSGvRCIASEWVYlaYEFGYGVdGDRLKEFMRDWNPSWIRDMTVLPPTPPAEvaDRSWNKGLDLKRfvkDmiGN
  996- 1068 (86.33/ 7.08)	...............................................................................................................................................................................................................LSPSSSTVIQLVP.QCALNPSCY..REIAFEV.YNRISEPVKEINARSISDPYGLSQHSTSD..DHLTRHAFTLAR...D..GN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.25|      22|      23|     853|     874|       4
---------------------------------------------------------------------------
  853-  874 (39.61/23.20)	DLSKESKQRFLPQP.QISAGYHN
  878-  900 (37.65/21.66)	NLSIPSLQYWSELGlQPHGGYKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.58|      23|      34|     295|     328|       5
---------------------------------------------------------------------------
  295-  328 (28.56/35.38)	IYwvpLSTP....SSSKGK......LTPRqlverwknSQGLLTI
  331-  363 (31.02/13.37)	TH...LAQPyfatRYPKGKksvvrpLQPK........SSDLLDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.73|      11|      15|    1138|    1148|       6
---------------------------------------------------------------------------
 1138- 1148 (23.87/16.33)	GK.SDDWLINWR
 1155- 1166 (17.85/10.04)	GKmYSDELQAWR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.90|      17|      35|      64|      82|       8
---------------------------------------------------------------------------
   64-   82 (28.21/21.57)	WRQIndSPNDQMFSVNNLE
  102-  118 (31.68/17.45)	WVFI..TSNDQIVPLDGLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      55.22|      13|      15|     536|     548|      10
---------------------------------------------------------------------------
  536-  548 (21.61/14.31)	VAEDDRMNLDL...NL
  554-  566 (19.32/11.79)	VQPDLTLNVEQ...DL
  571-  585 (14.29/ 6.27)	IPTQDQ.TLPLeahNL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09410 with Med13 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SSYKEPDPPLDHEDDEDEEADENIDVESTVITAEPEPEPIGNDVGGSEKSDIDDLFSEHSNSITNSPAPTIPLPIPPPDPILDQNGLEPVSISVNEDDTMNFINMDMNMDNENRQLSRNASNTNGLDNTQKEEMVTEDDFAFFDSPTDQIANEGELNESTQENHVAEDDRMNLDLNLPS
2) VEQDLLQIQIPTQDQTLPLEAHNLPTSSSYLNPTALVDDEDIHPEESPHPITADVTALPRQPPSPVPLPFQRS
3) VSTYANDWKMDEEISEIDEEEMYTGPPTPESAYTSSDEDEGNTFINDRKR
372
562
685
550
634
734










Molecular Recognition Features






MoRF SequenceStartStop




NANANA