<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09402
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MQQHPTILPPPALPDGSIPSRSREKEENLIRFQAELEFIQCLSNPQYLHSLSTQGYLGKETFINYLKYLEYWRKPQYVKFIVYPTSLIYLTLLQSSLFRERLADPVFVNELIRVGIKHHETWRTEKPQTANATTSTNNDYEKNVAPDGQIINNHFDDDG |
Length | 159 |
Position | Middle |
Organism | Kwoniella mangroviensis CBS 10435 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.606 |
Instability index | 30.29 |
Isoelectric point | 5.94 |
Molecular weight | 18541.68 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09402
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.20| 11| 49| 66| 76| 1
---------------------------------------------------------------------------
36- 46 (18.09/ 9.99) LEFIQCLS..NPQ
66- 76 (23.08/14.38) LKYLEYWR..KPQ
116- 128 (17.02/ 9.06) IKHHETWRteKPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.51| 18| 43| 47| 64| 2
---------------------------------------------------------------------------
47- 64 (32.20/19.62) YLHSLSTQGY...LGKETFIN
89- 109 (25.31/14.24) YLTLLQSSLFrerLADPVFVN
---------------------------------------------------------------------------
|