<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09395
| Description |
Cyclin C |
| Sequence | MSSSFWSSSHCLHWLITRPALLISRHLDLQYCTPKQLYCLHIFFTQLIQKLGKRLLLRQIPIATACTFFKRFYLKNSICETNPYLVLAACVFVAAKVEETPVHIKSVVSEAKVVFNEYNIKLFPAETNKLGEMEFYLLEDLDFHLVIFHPYRALLHITGREPADSGKFPLSRTEEDQRFKKKELETRKKKDEEIRKSNLNTVGNKPSPGVGLVNGNKDVNEDDENQLEAKRIRRLMGRGSTEGIGEVDEGVLQISWFILNDTYRTDVHLLYPPYIIAISAIYVAFCLTSMNSSSASRTRTSSSSSQLNSVQSSTTINEQLGLDPPPNSASNFLAGFQVNLNILFACVQDIIRLYSIWESFEPTSMRNTNNPQNQQQNHLKSVLGGASMTGTEDGIDGKKEKFGFEEAEVLVRKMIESRLVDMGHPNNAGANQTAKRSLPTGASDGIDQSSVIGKKRVRK |
| Length | 459 |
| Position | Kinase |
| Organism | Kwoniella pini CBS 10737 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.334 |
| Instability index | 50.58 |
| Isoelectric point | 8.62 |
| Molecular weight | 51675.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09395
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.65| 24| 53| 371| 399| 1
---------------------------------------------------------------------------
371- 399 (40.33/40.96) PQNQQQNHL..KSVLGGASmtgteDGID.....GKK
425- 455 (35.32/23.33) PNNAGANQTakRSLPTGAS.....DGIDqssviGKK
---------------------------------------------------------------------------
|