<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09383
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSGPPQQEAALPITNTLFPPPPSYFQAYTQANLDRYEELTGRPLLSSGKGKEKATVDNAQFDNHDDTVHRDTEAGSSESEEGKALREKLEKPRADWIEEDGRWMCFGQMYTTEPIIPTAESIGLPPLLDPALPPQESLPPLLHSFLHTLLLLLDALTNSARTPDELFHAGWAHEGDQYIQHLTNLSANMMVASNQLRGVQSEATLVMMMEKELEERKKQTEVLRRKCREIAAGIKVLRQSRS |
| Length | 242 |
| Position | Middle |
| Organism | Kwoniella heveanensis BCC8398 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.596 |
| Instability index | 51.43 |
| Isoelectric point | 5.15 |
| Molecular weight | 27159.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09383
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.20| 16| 119| 4| 20| 1
---------------------------------------------------------------------------
4- 20 (27.33/18.59) PPQQEAALPITNTLfPP
125- 140 (32.87/17.70) PPLLDPALPPQESL.PP
---------------------------------------------------------------------------
|