<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09381
Description |
Uncharacterized protein |
Sequence | MAAYTSSCSPSCGLWVWYTTASIETFVADIIRRSKDIKTLIAALPRKDDSAGRAQRLTELQEEMKTANEEYKAALAQSEELLIELQSALNEALGQGEDQDPVSIPTKLGSEEGVVIDGTHDEGIEVEE |
Length | 128 |
Position | Middle |
Organism | Kwoniella heveanensis BCC8398 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.366 |
Instability index | 74.97 |
Isoelectric point | 4.34 |
Molecular weight | 13974.37 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09381
No repeats found
No repeats found
|