<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09374
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDYFAYSPFWDSKSNNNVLRTQRRVENPTYGHAEEKIELNAFKSGFEYIVAHAQPPELFVIHKREVEPTGKRERVTGAWFVLHEKIYQSPTVYGVVSTRLRNAAHLISRTLGTLSESRPASNPRSTTVWRSITASASSSSSSQPKPTSTFDPAPSGNMEVDDAGDEKEKNGAVDGENGEEGSGQGQEFDWHLFHALQSTRSALSNIDEMARKPLSTSDPRAELRSIEANMTSQFSFLPQAQAQSQGQNQGRPSSVRSISIGPRTNFVNNAGLTPGLSPGLGSIFGNVAVGGSLAASSPRTTLGMGISPAPRAASIAAASPGIWTNGQN |
| Length | 328 |
| Position | Head |
| Organism | Kwoniella heveanensis BCC8398 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.562 |
| Instability index | 51.87 |
| Isoelectric point | 7.08 |
| Molecular weight | 35292.53 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09374
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.51| 33| 93| 111| 145| 1
---------------------------------------------------------------------------
111- 145 (53.26/37.22) LGTLSE..SRP..ASNPRSTtvWRSITASASSSSSSQPK
203- 239 (49.24/28.57) LSNIDEmaRKPlsTSDPRAE..LRSIEANMTSQFSFLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.24| 19| 105| 146| 164| 2
---------------------------------------------------------------------------
146- 164 (33.30/21.44) PTSTFDPAPSGNMEVDDAG
165- 183 (30.94/19.41) DEKEKNGAVDGENGEEGSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.30| 20| 21| 279| 298| 3
---------------------------------------------------------------------------
250- 274 (25.93/11.55) GRPSSVRSISIGPRTnfvnnAGLTP
279- 298 (32.77/16.40) GLGSIFGNVAVGGSL.....AASSP
303- 320 (29.60/14.16) GMG..ISPAPRAASI.....AAASP
---------------------------------------------------------------------------
|