<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09357
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MGHRMDYFAYSPFWDSKSNNNVLRTQRRVENPTYGHAEEKIELNAFKSGFEYIVSHSQPPELFVIQKREVDPSGKRDRVTGSWFILQERIYQSPTVYDVVSARLRNASHLIFKTLTSLSESHPSSNPRSTTLWRSLPPQAVSKPTSYEPLIEDQPNPNSDETLEADPQKKEDKEKEEASFDWHLYHSLQSTRQALPGLDEMSRNPVSRINPMEELRSIEAQLTAQFGITPSNPQVRPPGSIRSNSVRGTPGTSLPMGISPGMIIGQTPNLGGLNVASPRNLMGMSPGGISVGRATSIGNAGSPANMLQ |
| Length | 308 |
| Position | Head |
| Organism | Kwoniella bestiolae CBS 10118 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.671 |
| Instability index | 62.26 |
| Isoelectric point | 7.08 |
| Molecular weight | 34184.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09357
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 125.80| 25| 25| 256| 280| 1
---------------------------------------------------------------------------
226- 248 (40.14/19.52) FGITPSNP.QVRPP..GSIRSNSVRG
256- 280 (47.54/24.31) MGISPGMI.IGQTPNLGGLNVASPRN
282- 305 (38.12/18.21) MGMSPGGIsVGRATSIG..NAGSPAN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.82| 13| 27| 126| 139| 2
---------------------------------------------------------------------------
126- 139 (21.95/14.20) NPRSTTLWRSlPPQ
156- 168 (23.87/11.34) NPNSDETLEA.DPQ
---------------------------------------------------------------------------
|