<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09356
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MQQYPTILPPPCLPDGTDAPARSKEKEDNLIRFQAELEFIQCLSNPQYLHSLSTQGYFTKKTFINYLKYLEYWRKPEYVKFIVYPTSLIYLTLLQSELFRERLADPGFINELMRVGIKHHETWRVEKPPPTAVKDDTKGDDKKDVKENQPSHDEDDG |
| Length | 157 |
| Position | Middle |
| Organism | Kwoniella bestiolae CBS 10118 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Kwoniella.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.786 |
| Instability index | 28.68 |
| Isoelectric point | 5.60 |
| Molecular weight | 18437.69 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09356
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.38| 21| 117| 9| 29| 1
---------------------------------------------------------------------------
9- 29 (40.10/22.45) PPP.CLPDGTDAPARSKEKEDN
128- 149 (33.28/17.67) PPPtAVKDDTKGDDKKDVKENQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 129.60| 39| 48| 30| 74| 2
---------------------------------------------------------------------------
30- 74 (65.43/49.89) LIRFQAELEFIQCLSNPQYLHSLSTQGyftkktFINYL.....KYLEYWR
81- 124 (64.17/37.13) FIVYPTSLIYLTLLQSELFRERLADPG......FINELmrvgiKHHETWR
---------------------------------------------------------------------------
|