<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09347

Description Mediator of RNA polymerase II transcription subunit 17
SequenceMSGIPDNFPMSLRPWPTKEGNGSALPTLISRINAERGQFRNLTEEDLLEEIAKGENEAAADNEDMSTEDETEAAPDRQKEVMDAKAEMLAQLEQAHHASMIALDFVALLLSKDQPVQAGLSISDGLRQVVSLGTLGADRVKDTRLTEPRKKDIAAVGKGWKIQSFNTSVESILNAASRLETEIAAETKYWEAILSVDEKGWKTCKLPQEQHTLGVRFGFFDAAPAFSNRSLAALRRQPDGTAYLDHGAADPTPKRVLIQIETNGILTGALAPSTSAPDSSPLETLVLRSRNAVFEEELWQELNREARTLANHSVRMTGDEISCQLTPTTRILLRLEPLSTSPSTTTPEPRPHDEIVTMLSLALHLELSHAHRQNQRRRTQPPPPISSAPRPNPPYALLRPLLAYEHHIGILAALRATTASLTTTLCAASLDVPAATLVPATLTAATSTEERVAALLSSREAEFLVPLPAGQSVTIKLRSDLGIQTRFRVEITPALAAVCRAPPNPSVEEVRTFLRWAAGCAVVRAVVGKGEEGGVGEGLKGWRETASPCLVRKEVGGKSREIGVVVVEGRLELKVKSGKESRVVKWEVGGEDRGIWEVIEEVGKSDGTEGAWGDGHEVIREVMEIE
Length626
PositionHead
OrganismPseudogymnoascus verrucosus
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
Aromaticity0.04
Grand average of hydropathy-0.299
Instability index48.18
Isoelectric point5.40
Molecular weight68056.37
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364140
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP09347
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.51|      31|      38|     129|     161|       1
---------------------------------------------------------------------------
  129-  161 (47.78/40.33)	VVSLgtLGADRVKDTRLTEPRK..KDIAAVG.KGWK
  169-  202 (39.73/26.00)	VESI..LNAASRLETEIAAETKywEAILSVDeKGWK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     148.79|      37|      41|     334|     372|       2
---------------------------------------------------------------------------
  272-  330 (30.35/10.91)	........PSTSAPDSSPLETLVlrsrnavfeeelwqelnreartlanhsvRMTGDEISCQLTPTTR
  334-  372 (58.25/32.50)	RLEPlsTSPSTTTPEPRPHDEIV............................TMLSLALHLELSHAHR
  378-  415 (60.19/28.96)	RTQP..PPPISSAPRPNPPYALL...........................rPLLAYEHHIGILAALR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.66|      28|      32|     526|     557|       3
---------------------------------------------------------------------------
  516-  538 (23.23/16.76)	...W...AAGCAVVR....avvgkGEEGG..VGEG
  539-  569 (43.33/25.61)	LKGWRETASPCLVRKEVGG....kSREIGvvVVEG
  575-  590 (20.10/ 6.79)	VKSGKESR...VVKWEVGG................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.06|      21|      24|     422|     444|       5
---------------------------------------------------------------------------
  422-  444 (31.28/22.46)	TTTLCAASLDV.PAATLVPatLTA
  448-  469 (30.78/16.12)	TEERVAALLSSrEAEFLVP..LPA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09347 with Med17 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSGIPDNFPMSLRPWPTKEGNGSALPTLIS
2) TEEDLLEEIAKGENEAAADNEDMSTEDETEAAPDRQKEVMDAKAEML
1
43
30
89










Molecular Recognition Features






MoRF SequenceStartStop




NANANA