<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09345
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATRALDPPLDEIQWRSPAWAQQMMGIHSNSVLPYFAKSPFFDPTSNNAVLENQAMYNQNMVNIVATREAFEGRLKTMSGLEYVVAQEPAETAPGTGTGVWVIRKQTRRKRQGQEDDITIHSTYFVMGENIYMAPAFLDVVGSRMLSIFTSLDKFVSAANALPNFTPLSGHTYLPPVAARPKATDSQLATQTSRQSSPLSDSAGGSRKQVSGTTSTYMDARLLDESFQLSMRYGDEYMDENPITGHPGAFNLTSTGRKTKDALGAAAQKAGLQDASKIGVSLVDEKPSDIPPTRKGSKAADKAPRTPGIPKPKRKKSKVLSAGGVTPV |
| Length | 328 |
| Position | Head |
| Organism | Pseudogymnoascus verrucosus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.464 |
| Instability index | 43.90 |
| Isoelectric point | 9.41 |
| Molecular weight | 35516.79 |
| Publications | PubMed=29295979
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 219.91| 73| 90| 14| 98| 1
---------------------------------------------------------------------------
14- 98 (114.63/104.25) QWRSPAWAQQ.MMGIHSNsvlpYF..AKSPFFDPTSNNAVLENqamynqnMVNI.......VATREAFEGrLKTMSGLEYV..VAQEPAETAPGTGT
106- 190 (105.27/68.76) QTRRKRQGQEdDITIHST....YFvmGENIYMAPAFLDVVGSR.......MLSIftsldkfVSAANALPN.FTPLSGHTYLppVAARPKATDSQLAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.66| 15| 17| 284| 298| 2
---------------------------------------------------------------------------
284- 298 (29.75/15.41) DEKP..SDIP.PTRKGSK
301- 318 (20.91/ 9.00) DKAPrtPGIPkPKRKKSK
---------------------------------------------------------------------------
|