<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09337
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSTPIDSATNRSYPLSPTPNSEVKRSQPATFQPRTPQSPLQPNTASGEKVPNTRVSGNMSSTISRTVQGPTMADSHDSATPMSIDSSIQADDLSNKRKRESEDTGDREQKKAHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLGLDLFELYGLNPTAAKVARVLPSGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQNVFAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKAAAQVPSKPTSAGMQKSASQQSGAMSRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQQQYGPSRHGSYGPGMVGA |
| Length | 375 |
| Position | Head |
| Organism | Pseudogymnoascus verrucosus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.848 |
| Instability index | 47.71 |
| Isoelectric point | 8.90 |
| Molecular weight | 40687.17 |
| Publications | PubMed=29295979
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09337
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.90| 24| 71| 274| 297| 1
---------------------------------------------------------------------------
39- 63 (36.52/19.09) PLQPNTASGEKvPNTRVSGNMSSTI
67- 83 (22.74/ 9.25) VQGPTMADSHD.SATPMS.......
274- 297 (41.64/22.75) PSKPTSAGMQK.SASQQSGAMSRGS
---------------------------------------------------------------------------
|