<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09335

Description Mediator of RNA polymerase II transcription subunit 7
SequenceMADQQQGNVQASAFPSPPPFYQHFTEENLARVAILRAGRESDSSQKDDSPKEPELRGDLQYLQPPEPPAEGTYRSFGDLYNLNDILPSLTEQGIEQLYSPPATPSGSGAGSDPQSHSDRTLILKRIAKSLLLNFLELMGIMSVNPEQYAEKIQDLRTLFINFHHLLNEYRPHQARESLILMMEAQLARSKAETNGIENMKTKVEGILAGLGQVNIAPEEAEEYKDIKKDLEEYDGAKDVWDELHREYGLVEPGKS
Length255
PositionMiddle
OrganismPseudogymnoascus verrucosus
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
Aromaticity0.07
Grand average of hydropathy-0.682
Instability index63.38
Isoelectric point4.76
Molecular weight28609.62
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364060
ECO:0000256	ARBA:ARBA00003669
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP09335
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.43|      18|      34|      50|      68|       1
---------------------------------------------------------------------------
   50-   68 (31.75/20.43)	PKEPElRGDLQYLQPPEPP
   87-  104 (33.69/17.59)	PSLTE.QGIEQLYSPPATP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.08|      21|      25|     128|     150|       2
---------------------------------------------------------------------------
  128-  150 (30.99/28.02)	KSLLLNFLELMGimSVNPEQYAE
  156-  176 (39.09/27.50)	RTLFINFHHLLN..EYRPHQARE
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09335 with Med7 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) RVAILRAGRESDSSQKDDSPKEPELRGDLQYLQPPEPP
31
68










Molecular Recognition Features






MoRF SequenceStartStop




1) LRGDLQYLQ
2) PFYQHFTEENL
55
19
63
29