<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09330
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MATRALDPPLDEIQWRSPAWAQQMMGIHSNSVLPYFAKSPFFDPTSNNAVLENQAMYNQNMVNIVATREAFEGRLKTMSGLEYVVAQEPAETAPGTGTGVWVIRKQTRRKRNGQEDDITIHSTYFVMGENIYMAPAFLDVVGSRMLSIFTSLDKFVSAANALPNFTPLSGHTYLPPVAARPKATDSQLATQTSRQGSPLSYSAGGSRKQVAGTTSTYMDARLLDESFQLSMRYGDEYMDENPITGHPGAFNLTSTGRKTKDTLGAPAQKAGLQDSTKIGASPVDEKAPDIPPTRKGSKAADKAPRTPGIPKPKRKKSKVLSGGGVTPV |
| Length | 328 |
| Position | Head |
| Organism | Pseudogymnoascus sp. 05NY08 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.497 |
| Instability index | 44.06 |
| Isoelectric point | 9.48 |
| Molecular weight | 35516.80 |
| Publications | PubMed=29295979
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09330
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.43| 15| 15| 149| 163| 1
---------------------------------------------------------------------------
149- 163 (25.30/15.61) FTSL..DKFVSAANALP
165- 181 (24.13/14.58) FTPLsgHTYLPPVAARP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.19| 15| 17| 284| 298| 2
---------------------------------------------------------------------------
284- 298 (29.65/14.97) DE..KAPDIP.PTRKGSK
301- 318 (20.53/ 8.50) DKapRTPGIPkPKRKKSK
---------------------------------------------------------------------------
|