<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09323

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMDEWATFFAHALDRRLPTDKLEQFAKVLSTKSPLATPLIAELLLRPSESRYYDLDPQVSLYAQALLRTDVLDVPSVLRALLRHSTSRPVDAAKEEQEVASGSQARWIKSYGHEERLVYGLSKIVAAGDRPKSAQEALGTANALTEWMRLLVMANAADDMMREIGAGNDTHNQETMAVRVAVGALLVALAENATVNETLRNRCPKDTLKGFSQSLANFTPLLINGSSMFAERLELYTKTLVALEPIDKKAQKAGAEIDQIIDSAMAIGMDNIPVVDIPTMNSRAGLYVYLNSMLTGRPMVDDNQLLNFLHNRYQGDIQTTCIDLVVSSFDILANAIFRSENPQTTFLLRSFLINKVPLLISMISAPMFPPLSPELCITEALSHVDINAFPTFSSMFDDTSAGDMFSDSVRQDFCFSCCLHGLIPEESIERLLGEIPMQTLPAGGRYTKDEVLEQCLSDSEKIEAFTDELEHMDGNVGAVSQAITELLRRLCESKDTMALKSLCAHLARKPSSLDVLLIFDKPLTILPPICQLLDAWRYDDDQGEYQPVYEEFGSILLLVLAFVYRYDLSATELGVQTPDSFIAKLLVRGSTARLLDDLSSVESSQLDGWIKGLFNAEGGGLGDEPMALCPPQDFYLLVPTLFSQIVLASQHGHLTDDVLRGGLEYLLDPSLLPSLIPALLSLTSNILTTPPPASLLQALILPQSISAEASLLHNAILPIPAPHLSRSLRALQRSVPTRTDLDPLIAALRPHLHFSRTAIDLTTDFPVPPNLPIAVRHAARALINWNPPAAPPNYSPRLPVLAIRMLGARRALLALLEELGHQCALGNSGTAYDVVASLVCAPPKAAAGVQGRVTLREALATEAAKVGAEVGKEGPEAERAEVVVRLYRRVEALSAGGGIDEQAGLMSADLGIGGVGGEGLVGEDMMGVLSGEGMMGLEGGMLDDMKLDF
Length948
PositionTail
OrganismPseudogymnoascus sp. 05NY08
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.06
Grand average of hydropathy0.073
Instability index43.27
Isoelectric point4.82
Molecular weight102946.17
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09323
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     182.76|      47|      52|     361|     407|       1
---------------------------------------------------------------------------
  320-  344 (21.45/ 9.14)	..............CIDLVVSSFDILANAIFRSENPQTT........
  361-  407 (82.82/60.01)	MISAPMFPPLSPELCITEALSHVDINAFPTFSSMFDDTSAGDMFSDS
  412-  458 (78.49/56.42)	FCFSCCLHGLIPEESIERLLGEIPMQTLPAGGRYTKDEVLEQCLSDS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      91.45|      25|      27|     755|     781|       2
---------------------------------------------------------------------------
  735-  752 (29.90/14.65)	PTRTDL.......DP.LIAALR..PHLH
  755-  781 (40.47/28.78)	RTAIDLTTDFPV.PPNLPIAVRhaARAL
  828-  849 (21.08/ 7.36)	GTAYDVVASLVCaPPKAAAGVQ......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     146.44|      27|      27|     665|     691|       3
---------------------------------------------------------------------------
  593-  630 (31.27/16.09)	LLDdlssveSSQLDGWIKG..LFNAEGG.GLGDepmalCPP
  635-  662 (32.04/16.68)	LLV......PTLFSQIVLAsqHGHLTDD.VLR......GGL
  665-  691 (46.20/27.56)	LLD......PSLLPSLIPA..LLSLTSN.ILTT.....PPP
  694-  721 (36.92/20.42)	LLQ......ALILPQSISA..EASLLHNaILPI.....PAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     146.48|      33|      52|       1|      33|       4
---------------------------------------------------------------------------
    1-   33 (58.38/33.72)	MDEWATFFAHALDRRLPTDKLE..QFAKVL...STKSP
   54-   88 (36.08/18.26)	LDPQVSLYAQALLR...TDVLDvpSVLRALlrhSTSRP
  188-  219 (52.03/29.32)	LAENAT.VNETLRNRCPKDTLK..GFSQSL...ANFTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.96|      19|      37|      90|     108|       5
---------------------------------------------------------------------------
   90-  108 (31.95/19.72)	DAAKEEQEVASGSQA..RWIK
  128-  148 (29.01/17.28)	DRPKSAQEALGTANAltEWMR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09323 with Med5 domain of Kingdom Fungi
Unable to open file!