| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSSTISRTVQGPDMADTHDSATPMSIDSSIQADDLSNKRKRESEDTGDREQKKAHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLGLDLFELYGLNPTAAKVARVLPSGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQNVLAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKAAAQVPSKPTSAGMQKTASQQSGAMSRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQQQYGPSRHGSYGPGMVGA |
| Length | 317 |
| Position | Head |
| Organism | Pseudogymnoascus sp. 05NY08 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.809 |
| Instability index | 38.79 |
| Isoelectric point | 7.70 |
| Molecular weight | 34489.43 |
| Publications | PubMed=29295979 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09321
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.41| 14| 19| 65| 80| 2
---------------------------------------------------------------------------
65- 80 (21.88/25.03) DLHLDVGKIYQLcrTP
87- 100 (26.53/19.76) DLGLDLFELYGL..NP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GPGKRRKKSALNQQQYGPSRHGSYGPGMVGA 2) GYVDDDMVDAGYSTG | 287 266 | 317 280 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab