Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSSTISRTVQGPDMADTHDSATPMSIDSSIQADDLSNKRKRESEDTGDREQKKAHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLGLDLFELYGLNPTAAKVARVLPSGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQNVLAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKAAAQVPSKPTSAGMQKTASQQSGAMSRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQQQYGPSRHGSYGPGMVGA |
Length | 317 |
Position | Head |
Organism | Pseudogymnoascus sp. 05NY08 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.809 |
Instability index | 38.79 |
Isoelectric point | 7.70 |
Molecular weight | 34489.43 |
Publications | PubMed=29295979 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09321 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.41| 14| 19| 65| 80| 2 --------------------------------------------------------------------------- 65- 80 (21.88/25.03) DLHLDVGKIYQLcrTP 87- 100 (26.53/19.76) DLGLDLFELYGL..NP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GPGKRRKKSALNQQQYGPSRHGSYGPGMVGA 2) GYVDDDMVDAGYSTG | 287 266 | 317 280 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab