Description | Uncharacterized protein |
Sequence | MEKKRSFSSGDRRSRSRSASADQTANEASQAAITHDGAVTHVSPLASLSPPRPSATLRTGPSTNELMEREQGIVDAMLLRFKNIIELATTNKGDVTAEVAAAQAFQTNVETQALIRAAQDLLSLTREMKELWLFGPLRGLGEGEEGDSIDDNSKRVVEMVEAMIEERTRRET |
Length | 172 |
Position | Head |
Organism | Pseudogymnoascus sp. 23342-1-I1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.547 |
Instability index | 55.32 |
Isoelectric point | 5.20 |
Molecular weight | 18828.84 |
Publications | PubMed=29295979 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09314 No repeats found |
MoRF Sequence | Start | Stop |
1) MEKKRSF 2) MIEERTRRET | 1 163 | 7 172 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab