<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09311

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMENGYGTGAHTNHDRNEAPNGTNGALQASSRAAEKTSLPNQQQSPNQSIQMNGSNGAPMTQSADQPAGSVSKNANIQTKGTPPEINHITEGFESLPNLLTRLAQVTHNQLSGKLLELAGMNIQQSPDNSNAVSFVSGPDDNSAENIKKKVNLLKFAEGVHSNWTKALVITKWSRISEEVSRVIDLKAHLDEQKLYYDIAVHELSEVKRSLVHARLPNPDLRTAVEVLSTGKASWMPDLGYIEPPPLTAKEILQSLQNLNTLLSIRLNLHDYDKIPYHFRNYTIKSGRVTFRVEGEFEVDLTIADEDPDKQFWFIDFRFLFSPSPSALTDQMRYSLEAKVNTVLEKDGLAGCYKVLHDLTLTHKISELRRQAYEIGRSRWIDSLMVEPLRRSISIQYWVDRYGKDGPKSWVIIGVVSGKKDAAYHDEKETSRIGIRWFRDSKEVKDVEIPLELTTLSVEGLLRSVITMHVSHILDNMYKSLRAKPLYANRDLALSFKKPTTAEQEPELHVQLTSQYRINVIVEYITGKFAISPSSRLTSQAEYRLNNQTVDPASNGHEYIENLHCVLISEDTVSRAYTVGWLPVRNPRLPQDELKPFLPRDTLQLSWFQKPGWDPNWYLALSSGMSGERWWLIEITNVPEGPKSESIVLDGPTVRSHIQLPLKSVSPAPTYAFLSSLHLLSTSMISYYTNMRALHSRRAKFMLRNTPKSMLSSRQGQPALYVMLSTLLPSKNKSPRTGKPWAKDVLKVSFQGIETLEPKETASSPAGGSDQSPSNPPTAPSGPVGPRQPDTEEGAIMIAEGHMETAIPAGLLVKQHVDKDIAFHPSTSAFAFRLRARVGEPCITPLIERLQRVERLVDFVQVINAHPDSLHCESVSLSRLIFSYGCVQSQGPNQPHTESPRYQAIIDFSSQTSHLELQLEAGNPHIRILDYLNKILNSPLGLNGLATILPLTLPVLRALDAAEDSWDDIPSSELQILCRAADWYAVRYILTPPSEGENKAPAAPKRVVFEIRLQRRGNVPWWCMRRDQKHNAATVDPLDLALKEKVWTGGEKGVWMGMQCAAIAQTGGAEAMVLRVDSAVRDLAKDGTVFASAPPGVAGVKGEGVAGEITDGLGGQTGQMQAQAVNVPKAQPQRPQTKSPVLQKQTQKKAQGLPPTQQQRTQAALAEAQHRAQFQAQQLARQKEMHRQAQIQARQGQGQQRPNANANSGNGNSGKQDAIVID
Length1221
PositionTail
OrganismPseudogymnoascus sp. 23342-1-I1
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.06
Grand average of hydropathy-0.459
Instability index47.62
Isoelectric point8.43
Molecular weight135513.03
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP09311
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.75|      25|      29|    1118|    1146|       1
---------------------------------------------------------------------------
 1122- 1146 (43.38/30.76)	QAVNVPKAQPQRPQTKSPVLQKQTQ
 1148- 1172 (42.37/20.12)	KAQGLPPTQQQRTQAALAEAQHRAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.20|      22|      29|      20|      46|       2
---------------------------------------------------------------------------
   20-   46 (29.86/35.98)	NGTNGAlqASSRAAEKtslPNQQQSPN
   52-   73 (40.35/28.73)	NGSNGA..PMTQSADQ...PAGSVSKN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.09|      17|     180|     470|     487|       3
---------------------------------------------------------------------------
  470-  487 (26.42/18.46)	SHILDNMyKSLRAKPLYA
  655-  671 (29.67/15.86)	SHIQLPL.KSVSPAPTYA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.77|      22|      27|     199|     225|       4
---------------------------------------------------------------------------
  203-  225 (32.56/28.98)	LSEVKRSLVH..ARLPNPDLrTAVE
  227-  250 (34.20/15.06)	LSTGKASWMPdlGYIEPPPL.TAKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.08|      23|      27|     870|     895|       5
---------------------------------------------------------------------------
  872-  895 (38.87/36.74)	ESVSLSRLI.F....SYGCVQSQGPNqPH
  897-  924 (32.21/16.10)	ESPRYQAIIdFssqtSHLELQLEAGN.PH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.05|      20|     109|     491|     513|       7
---------------------------------------------------------------------------
  491-  510 (33.48/29.17)	LALSFKKPTTAEQEPELHVQ
  528-  547 (33.57/19.22)	FAISPSSRLTSQAEYRLNNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.42|      15|      31|     723|     737|       9
---------------------------------------------------------------------------
  723-  737 (25.84/14.88)	LSTLLPSKN.KSPRTG
  752-  767 (21.58/11.12)	IETLEPKETaSSPAGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.27|      29|      31|     551|     580|      10
---------------------------------------------------------------------------
  551-  580 (46.65/36.07)	PASNGHEYIENLHcVLISEDTVSRAY..TVGW
  582-  612 (50.62/33.14)	PVRNPRLPQDELK.PFLPRDTLQLSWfqKPGW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09311 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LEPKETASSPAGGSDQSPSNPPTAPSGPVGPRQPDTEEGAIMIAE
2) MENGYGTGAHTNHDRNEAPNGTNGALQASSRAAEKTSLPNQQQSPNQSIQMNGSNGAPMTQSADQPAGSVSKNANIQTKGTPPEINHITEGFE
3) VKGEGVAGEITDGLGGQTGQMQAQAVNVPKAQPQRPQTKSPVLQKQTQKKAQGLPPTQQQRTQAALAEAQHRAQFQAQQLARQKEMHRQAQIQARQGQGQQRPNANANSGNGNSGKQDAIVID
755
1
1099
799
93
1221










Molecular Recognition Features






MoRF SequenceStartStop




NANANA