| Description | Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPTHKFQRVLTYEGPNAQLVPIPASRVQNRRPQDREVWNELNKQLVRQSHYITLAYPTEKGEFGAGADVGGGEDQAVEKPVIDLEEARGTLHFYDYPDPPHPSRPVNSRLVIHIPDEPKLPSLLRSIKYTQHSESLREIYNFYRDNVTFTLSRELQRKQQQDGVMEMDGGVPPQAYSDIRDYIPFDAENKWVLKASVEVTDEKEGPLVQRGIEELLKVQSDLAGLYEFSILDRAVLDTRVPAFLEQLRRR |
| Length | 278 |
| Position | Head |
| Organism | Pseudogymnoascus sp. 23342-1-I1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.571 |
| Instability index | 61.18 |
| Isoelectric point | 5.57 |
| Molecular weight | 31778.61 |
| Publications | PubMed=29295979 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09308
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 136.08| 38| 40| 187| 225| 1
---------------------------------------------------------------------------
159- 183 (23.20/11.49) .................QHSESLREIYNFYRDNvTFTLSREL
187- 225 (60.41/47.12) QQQDGVMeMDGGVPP..QAYSDIRDYIPFDAEN.KWVLKASV
229- 268 (52.48/35.73) DEKEGPL.VQRGIEEllKVQSDLAGLYEFSILD.RAVLDTRV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RLVIHI 2) TLHFYDYP | 137 118 | 142 125 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab