<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09307

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMSTPIDSSTNRSYPLSPTPNSEVKRSQPASFQPRTPQSPLQPNTASSEKVPNTKVSGSMNSTISRTIQGPAMADARDSATPMSIDSSIQADDLSNKRKREAEDTGDRDQKKAHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLGLDLFELYGLNPTAAKVARVLPTGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQNVFAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKPATQVPSKPTSAGMHKSASQQSGATSRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQPQYGPSRHGSYGPGMVGA
Length375
PositionHead
OrganismPseudogymnoascus sp. 23342-1-I1
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.05
Grand average of hydropathy-0.853
Instability index46.46
Isoelectric point9.01
Molecular weight40666.17
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP09307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.41|      14|      19|     123|     138|       1
---------------------------------------------------------------------------
  123-  138 (21.88/24.12)	DLHLDVGKIYQLcrTP
  145-  158 (26.53/19.09)	DLGLDLFELYGL..NP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.45|      14|      20|      63|      76|       2
---------------------------------------------------------------------------
   63-   76 (23.84/14.90)	ISRTIQGPAMADAR
   84-   97 (22.60/13.78)	IDSSIQADDLSNKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.34|      18|     232|      22|      57|       3
---------------------------------------------------------------------------
   33-   57 (28.25/42.91)	PRTPQSPLQPNTASSEkvpntkvSG
  274-  291 (32.09/ 9.72)	PSKPTSAGMHKSASQQ.......SG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     111.25|      31|      45|     295|     326|       4
---------------------------------------------------------------------------
  295-  326 (51.36/33.89)	RGSKADlARPKRAVKKRGYDESSFEGYGEGYV
  343-  373 (59.89/35.76)	RGGPGK.RRKKSALNQPQYGPSRHGSYGPGMV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP09307 with Med19 domain of Kingdom Fungi

Unable to open file!