<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09307
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTPIDSSTNRSYPLSPTPNSEVKRSQPASFQPRTPQSPLQPNTASSEKVPNTKVSGSMNSTISRTIQGPAMADARDSATPMSIDSSIQADDLSNKRKREAEDTGDRDQKKAHVEERKLCIEDLHLDVGKIYQLCRTPHPYKQPDLGLDLFELYGLNPTAAKVARVLPTGEKNGLRKTYKGKIKDLGISGKFDVTVNDEESSGGLLSMMREPEHEWMVTQRLGKEIEKGLPQNVFAALPAAMTMAKGVIPKQMWDSSVLGELDIPEKKPATQVPSKPTSAGMHKSASQQSGATSRGSKADLARPKRAVKKRGYDESSFEGYGEGYVDDDMVDAGYSTGEGDDRGGPGKRRKKSALNQPQYGPSRHGSYGPGMVGA |
Length | 375 |
Position | Head |
Organism | Pseudogymnoascus sp. 23342-1-I1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.853 |
Instability index | 46.46 |
Isoelectric point | 9.01 |
Molecular weight | 40666.17 |
Publications | PubMed=29295979
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP09307
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.41| 14| 19| 123| 138| 1
---------------------------------------------------------------------------
123- 138 (21.88/24.12) DLHLDVGKIYQLcrTP
145- 158 (26.53/19.09) DLGLDLFELYGL..NP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.45| 14| 20| 63| 76| 2
---------------------------------------------------------------------------
63- 76 (23.84/14.90) ISRTIQGPAMADAR
84- 97 (22.60/13.78) IDSSIQADDLSNKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.34| 18| 232| 22| 57| 3
---------------------------------------------------------------------------
33- 57 (28.25/42.91) PRTPQSPLQPNTASSEkvpntkvSG
274- 291 (32.09/ 9.72) PSKPTSAGMHKSASQQ.......SG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 111.25| 31| 45| 295| 326| 4
---------------------------------------------------------------------------
295- 326 (51.36/33.89) RGSKADlARPKRAVKKRGYDESSFEGYGEGYV
343- 373 (59.89/35.76) RGGPGK.RRKKSALNQPQYGPSRHGSYGPGMV
---------------------------------------------------------------------------
|