| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTSLNSDEMRAIDQTRTRLDQLTKSIGALKNDILRSPVMPPIDSIQVHSTILAQSLKNITDHLSKHSDLFSQTVVYPSTNFPGRTQEGLVGQLLRKKLEPSAESWVEEGRALGKSESAGGAQDEDLDELWSFAKDYVLPQVAKAAQLSRSSLDDIYAESDGEDEEEEEEEGEGEGEGGEKKHAYGDGGSRNPAGVSRDLNAITRFMTTGTAVGN |
| Length | 214 |
| Position | Head |
| Organism | Pseudogymnoascus sp. 23342-1-I1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.699 |
| Instability index | 51.84 |
| Isoelectric point | 4.59 |
| Molecular weight | 23268.23 |
| Publications | PubMed=29295979 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09298
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.93| 29| 57| 92| 120| 1
---------------------------------------------------------------------------
92- 120 (50.71/23.03) QLLRKKLEP.SAES...WVEEGRALGKSESAGG
146- 178 (41.22/17.73) QLSRSSLDDiYAESdgeDEEEEEEEGEGEGEGG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AGVSRDLNAITRFMTTGTAVG 2) EEEEE 3) EGGEKKHAYGDGG 4) SLDDIYAE | 193 166 176 151 | 213 170 188 158 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab