<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09290
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPAHTYQRVLTYEGPSAQLVPIPAARVQNRRPQDREVWNELNKQLVRQSHYITLAFAAEKGEFGGGAEDQGVEKPVIDLEEARGTLHFYDYPEPPHPSRPVNSRLVIHIPDEPKLPSLLRSIKYTHYSESLREIYNFYRDNVTFTLSRELQRKQQNGVMETDGSVLQASSDIRDYIPFDGENKWVLKASVEVTDEKEGPLVQRGIEELLKVQSDLAGLYEFSILDRAVLDTRVPAFLEQLRRR |
| Length | 271 |
| Position | Head |
| Organism | Pseudogymnoascus sp. WSF 3629 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus>
unclassified Pseudogymnoascus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.508 |
| Instability index | 62.40 |
| Isoelectric point | 5.69 |
| Molecular weight | 30957.70 |
| Publications | PubMed=29295979
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09290
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.12| 13| 18| 190| 202| 1
---------------------------------------------------------------------------
190- 202 (23.09/17.99) DGS...VLQASSDIRD
207- 222 (17.03/11.47) DGEnkwVLKASVEVTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.63| 19| 19| 111| 129| 2
---------------------------------------------------------------------------
103- 127 (33.02/18.81) PVidleeaRGTLHFYDYPEPPHPSR
128- 148 (29.61/16.18) PV....nsRLVIHIPDEPKLPSLLR
---------------------------------------------------------------------------
|