Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPAHTYQRVLTYEGPSAQLVPIPAARVQNRRPQDREVWNELNKQLVRQSHYITLAFAAEKGEFGGGAEDQGVEKPVIDLEEARGTLHFYDYPEPPHPSRPVNSRLVIHIPDEPKLPSLLRSIKYTHYSESLREIYNFYRDNVTFTLSRELQRKQQNGVMETDGSVLQASSDIRDYIPFDGENKWVLKASVEVTDEKEGPLVQRGIEELLKVQSDLAGLYEFSILDRAVLDTRVPAFLEQLRRR |
Length | 271 |
Position | Head |
Organism | Pseudogymnoascus sp. WSF 3629 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.508 |
Instability index | 62.40 |
Isoelectric point | 5.69 |
Molecular weight | 30957.70 |
Publications | PubMed=29295979 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09290 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.12| 13| 18| 190| 202| 1 --------------------------------------------------------------------------- 190- 202 (23.09/17.99) DGS...VLQASSDIRD 207- 222 (17.03/11.47) DGEnkwVLKASVEVTD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 62.63| 19| 19| 111| 129| 2 --------------------------------------------------------------------------- 103- 127 (33.02/18.81) PVidleeaRGTLHFYDYPEPPHPSR 128- 148 (29.61/16.18) PV....nsRLVIHIPDEPKLPSLLR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RLVIHI 2) TLHFYDY | 132 113 | 137 119 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab