<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09284

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMDEWATFFAHALDRRLPTDKLEQFTKVLSTKSPLATPLIAELLLRPSESRHYDLDPQVSLYTQALLRTDILDVPSVLRTLLRHSTSRPVDAAKEEQEVTSGSQTRWTKSYGHEERIVYGLSKIVAAGDRPKSAQEALGTANALTDWMRLLVMSNAADDMMREIGAGNDTHNQETMAVRVAVGALLVALAENATVNEALRNRCPKDTLKGFSQSLANFTPLLINGSSMFAERLELYTKALVAMEPIDKKAQKAGAEIDQIIDSAMALGMDNIPVVEIPTMNSRAGLYVYLNSLLTGRPMVDDNQLLNFLHNRYQGDIQTTCIDLIVSSFDILANAIFRSENPQTTFLLRSFLINKVPLLISMISAPMFPPLSPELCITEALSHVDTNAFPTFSSMFDDTSAGDMFSDSVRQDFCFSCCLHGLIPEESIERLLGEIPMQTLPAGGRYTKDEVLEQCLSDSEKIEAFTDELEHMDGNVGAVSQAITELLRRLCESKDTMTLKSLCAHLARKPSSLDVLLIFDKPLTILPPICQLLDAWRYDDDQGEYQPVYEEFGSILLLVLAFVYRYDLSAIELGVQTPDSFIAKLLVRGSTARLLDDLSSVESSQLDGWIKGLFNAEGGGLGDEPMALCPPQDFYLLVPTLFSQIVLASQHGHLTDDVLRGGLEYLLDPSLLPSLIPALLSLASNILTAPPPSSLLQALILPQSISAEASLLHNAILPIPAPHLSRSLRALQRSIPTRTDLDPLIAALRPHLHFSRTTIDLTTDFPVPPNLPIAVRHAARALINWNPPAAPPNYSPRLPGLAVRMLGARRALLALLEELAHQCALGNSGTAYDVVASLVCAPLKAAAGVQGRVTLREALATEAAKMGAEVGKEGPEAERSEVVVRLYRRVEALSAGGGIDEQAGLMSADLGIGGVRGEGLVGEDMMGVLSGEGMMGLEGGMLDDMKLDF
Length948
PositionTail
OrganismPseudogymnoascus sp. WSF 3629
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus> unclassified Pseudogymnoascus.
Aromaticity0.06
Grand average of hydropathy0.046
Instability index44.41
Isoelectric point4.86
Molecular weight103193.40
Publications
PubMed=29295979

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09284
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.49|      23|      26|     665|     690|       1
---------------------------------------------------------------------------
  646-  680 (27.14/ 9.55)	LASqhGHLTddvlrggleyLLDPSLLPSLIPALLS
  681-  709 (27.34/14.22)	LAS..NILT....apppssLLQALILPQSISAEAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      73.15|      24|      27|     755|     781|       2
---------------------------------------------------------------------------
  721-  741 (29.77/11.33)	.......PHLSRSLRALQRSI.PTRTDLD
  742-  761 (17.86/10.84)	PLiaalRPHLHF.........sRTTIDLT
  765-  781 (25.52/11.14)	PV....PPNLPIAVRHAARAL........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     101.86|      30|      36|      24|      53|       3
---------------------------------------------------------------------------
   24-   53 (51.55/37.68)	FTKVLSTKSPLATPLIAELLLRPSESRHYD
   61-   90 (50.31/36.56)	YTQALLRTDILDVPSVLRTLLRHSTSRPVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.47|      29|      36|     353|     382|       4
---------------------------------------------------------------------------
  365-  400 (39.94/29.63)	PMFP.PLSPELCITEALsHvdtNAFP......TF..SSMFddtSA
  402-  439 (38.52/23.56)	DMFSdSVRQDFCFSCCL.H...GLIPeesierLLgeIPMQ...TL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.88|      13|      25|     903|     916|       6
---------------------------------------------------------------------------
  903-  916 (19.61/16.39)	GLMSADlGIGGVRG
  926-  938 (24.27/15.17)	GVLSGE.GMMGLEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     115.59|      27|      27|     557|     583|       8
---------------------------------------------------------------------------
  522-  537 (22.21/10.04)	......LTILPP.....ICQ...LLDA..WRY
  538-  565 (28.50/15.04)	D..D.DQGEYQPvyEEFGS.illLVLAFVYRY
  566-  593 (38.48/22.94)	DLSAIELGVQTP..DSFIAK..lLVRGSTARL
  596-  615 (26.40/13.37)	DLSSVE.SSQL...DGWIKG...LFNA.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.16|      25|     208|     235|     259|      10
---------------------------------------------------------------------------
  229-  244 (18.35/ 9.62)	.........AERLEL..YTKAL.VAME..P
  245-  272 (31.68/23.12)	IDKKAQKAGAEIDQI..IDSAMaLGMDniP
  276-  297 (29.13/20.54)	IPTMNSRAG.....LyvYLNSL.LTGR..P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.96|      28|     288|     194|     227|      11
---------------------------------------------------------------------------
  194-  227 (41.79/46.46)	VNEALRNRC.PKDT..LKGFSQSLANfTPllingSSM
  482-  512 (41.17/27.31)	ITELLRRLCeSKDTmtLKSLCAHLAR.KP.....SSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.26|      11|      20|     840|     850|      13
---------------------------------------------------------------------------
  840-  850 (18.39/ 9.58)	APLKAAAGVQG
  863-  873 (18.87/10.00)	AKMGAEVGKEG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09284 with Med5 domain of Kingdom Fungi
Unable to open file!