<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09274

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMSDPAGEIVHITQGYIPLSKVLTRLAQTTHNALQDQIAALAKMPLPAAAMNGNSTIPNGDTDDVSSENIAKKTSILNFAMREHRKWVKALVITEWSRKADMVSQLIDLRFHLQGQEVLFTGALDVMGHVKRDLTFARMPSPDLKTALQVLSTGEAAWMPDLSYIEPPPLTREEEIQWMSDVNTQLSLRLNLEDFDKIPYPFRTYEIDSGRVTFKVPGEFEVDLTIADEDFEKQFWFIDFRFAFRPAASSIPEGLKNYLESHVNDILSKDGLLGCYQFLHELVLTHKLNELKRQANQMSRGSWTGTLKVEPLNRALAIQYWTSRAQSGSPKSWVLVAVTSGKKANGQPDPKLSSHLTAKWYRDNKEVKGEHITFDADDLSAEALMKTVIGRHIDFLLGSVHSKLLSFPRFQNRQAAMVLRSSQDDPAASSLTMRVGFKDSTTLLIEPTTGVFAVKPHSKFTWSPENQLNNGKNPAEDGAACLENVRCAVMEDELSRRGSTTGWSIKRSPLNKDELRSLTNTREWTKTIWLHRAGWETNWFVMVLLSPSGDVWWLVDVNRNASGQAPRLASKLPLNKGYPRLDDEFWNNLTLFASGMIAQAVDQRELHKQNIKFKPHGANNWSLPQQVRLPTLEIALSGIFPSMVFGNAEKDNPKTAGVAESSKSGPIVRSVSASGISTKQPWANDIVSVRFKGVQPAEAESTGPESAKPGDDKPEIPFTCVSDAIIKVRRPAKFAMLKSHMVGRDVSWNARTGEFCLRMRSSIGQSMLESLKARVKAVDRFVSFFESMDKAKESIVAESVSLKEVTFSYGSLVSEASNKDQLSRLWRITLNLSQNDIDLIMGETNPHLPVTNLMQKLVNGANGIEALMNWLPGSLPALEAVKKIRETWRDVESRHQGRFRFMMDSVDEMSIQYSLAGTGSGNHLIYRDITLLAHIKHRRGEPWWHIMRKPFNDALAPNDEFSKALKPVWEATGEKWTGLVTGAAGRPHDGIASLLLAIDEAVRPLAGSSFQNNSEVVVLE
Length1019
PositionTail
OrganismFusarium poae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
Aromaticity0.08
Grand average of hydropathy-0.344
Instability index36.70
Isoelectric point7.72
Molecular weight113878.45
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09274
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     114.54|      32|      35|     471|     502|       1
---------------------------------------------------------------------------
  471-  502 (57.66/45.98)	KNP.AEDGAACLENVRCAVMEDELSRRGSTTGW
  506-  538 (56.88/45.24)	RSPlNKDELRSLTNTREWTKTIWLHRAGWETNW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.32|      12|     300|      60|      71|       2
---------------------------------------------------------------------------
   60-   71 (20.78/15.59)	DTDDVSSENIAK
  374-  385 (20.54/15.31)	DADDLSAEALMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     150.87|      36|     300|     539|     587|       3
---------------------------------------------------------------------------
  326-  355 (26.17/ 7.44)	.SGSPKSWVLVAVtsGKKANGQPdPKLSSHL........
  544-  579 (65.96/58.88)	LSPSGDVWWLVDV..NRNASGQA.PRLASKLPLNKGYPR
  590-  624 (58.74/25.16)	LFASGMIAQAVD...QRELHKQN.IKFKPHGANNWSLPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.04|      14|      23|     122|     139|       4
---------------------------------------------------------------------------
  122-  139 (19.82/21.81)	ALDVMGHVKRdltfARMP
  146-  159 (25.22/14.61)	ALQVLSTGEA....AWMP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.33|      32|     179|     692|     753|       5
---------------------------------------------------------------------------
  656-  689 (50.49/18.14)	GV..AESSKSGPivRSVSASGISTKQPW...ANDIVSVR
  692-  728 (45.84/73.01)	GVqpAEAESTGP..ESAKPGDDKPEIPFtcvSDAIIKVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.52|       9|     192|      46|      59|       7
---------------------------------------------------------------------------
   46-   59 (12.95/18.35)	PAAamngnSTIPNG
  245-  253 (18.57/ 9.25)	PAA.....SSIPEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      89.13|      30|     595|     389|     418|       9
---------------------------------------------------------------------------
  389-  418 (53.85/34.20)	GR.H..IDFLLGSVHSKL..LSFPRFQNRQAAMVL
  984- 1018 (35.28/19.93)	GRpHdgIASLLLAIDEAVrpLAGSSFQNNSEVVVL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09274 with Med14 domain of Kingdom Fungi
Unable to open file!