<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09271
| Description |
Uncharacterized protein |
| Sequence | MSASYWQSTQCRFWTFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLYICFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVVATAIYLACKIEESPQHIRVIVTEARQMWGDVAIDTSKLGECEFFMISEMRSQLIVYQPYRTVVALRSELGLQEDEVQLARSVINDHFMTDLPLLYPPHVIAMVAMLLALVLRPNNSGPGQNASGAAAAAGLAAAQQALMRAQGQQTPGGGGTTEAATAEPKERQQQARVSRVQKFAKWLVDSNVDIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
| Length | 320 |
| Position | Kinase |
| Organism | Fusarium poae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.271 |
| Instability index | 52.95 |
| Isoelectric point | 8.89 |
| Molecular weight | 36463.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP09271
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.31| 22| 27| 209| 230| 1
---------------------------------------------------------------------------
209- 230 (36.42/24.72) NSGPGQNASGAAAAAGLAAAQQ
238- 259 (38.90/26.87) QQTPGGGGTTEAATAEPKERQQ
---------------------------------------------------------------------------
|