<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09270

Description Uncharacterized protein
SequenceMTSRTPMGAHPRPPQRSVSSSSLPVQRPPPQRTLSHQQHFVPASPVRKDSSFIDLTADAGDTTPNRYNTTPRRGGSRLRLELSHNASASSLPTSESPQSLTPSRIPANSDPFQTVVGSPVPINSANSTSMPMPTRRPIASHLRSAPPVTTTTTPALSKKDTRPKPYTVEVPSAAPRYFAANRPETTPRNPVDPFSKGLNSGYADFFPWNGAHHEDEWSSEAITKGTWDKVNLNVPETSSAKLAIFPALKQKTGLTGLTALSTIFMGVLTQRRHRGQINAPSTFKPPPRVTLTDTKREVWLKDLANPAISLRRLSRTIPHGIRGRTLLDQCLNKNVPAERAVWLAKCVGANEIRGLKRKGVNGAFVMGGELKWARDWTVFVEQFVDSVVTGFSEKDWKARVTYAIRLATNLYSEQLLDRDHYLDWVVSGIENSLQSRIPMWLLIAQIYWKDILRFRKYGRRLVFALLSHLHVIYNDPDQDLLVQLSSRLSTLLSSLVLSNPESFINPGAWPRYKNTLQAFLRTDHEPTQKSLHIINSRNSRLVVSSTASPPAGRSQLVKLLDAALKESSDDHLAATCWATSENKPLIMKTVVEWATSFHRPGLAKVYAAARLIRQWSQFRVNPTTPILETLDSISIEDKTRKNLIYHLVTELVRTGHFSVSQYMQWTIARGGYHSGAEIDADSGPCSSRLLVELPLHALSDKKRAERGNLLRRAGNYSIAEEEQDISNAIKFVRHTVGLPLSPGDPLSERKPVSLKRLLPRLSSSSGALRSSIGAHLRDVLTCQFNHNNQPSLPLTMYNSVRAIMETAEDYSMLSDVLGACSKTADYDVLASVADTVHSNLQIFSALGSANDLFNILIERLKSMNEEQGIVPRPLLASLSSLAQRMTGHEVIASHLRQELFQSDRSNAVDACSPVSDIVVAPTQHAENELAEDIEKQLSSGTRLDPPTMNKLFRRIIPALERGWEKTDDTRRVFAILLTRIRVFDAHHFDKLMTDWTSHVRSLSSRPPLVSLFPLLVSTGCLTMPILMSTASPPSASFQNLPSDSSGNKFGPATYLQELLQLIIMPLPSGTGLSAEEGYRFHTEQKCAKFEQSKGLLNLVRNALLEYSGLRSHANGPEFPLDNPTCQESLLETLRTLVLVDSSAVSNALGIKSLPAEAVGLVRKVTTKLLIPGDSGDTQISFDHILQIANELTLPFCQLKLNLDLSLPQPNANEGQDQGSSRFEVFAKAMDRAIEAGNIMWTSLLPCLSDDITHHLKSQAQSVFLELIPSSKAPECADTVSRQSLRMAENLLEVAEAIISGQPPPKVAQLSSGMVDKLTDLWEIIAAGTHERPNCYAAVLQHWLPAMLRFITLHSLSSEPPSAPLPTASATRPPISPVHDTRARIILVLCGLLLELDTLSPAIVGSLPQQVFDIAILLVDALPEDLRANCAKAILLTSGGLPNQGTSSDPRLYYLFSSPPPSVADNIMLSHREKAATPQSAVARGMGAQYRIGPAVQERLTPFVLRRWEVLSEPTPNVGENDTSLSLGLFEAIKLQ
Length1535
PositionKinase
OrganismFusarium poae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
Aromaticity0.06
Grand average of hydropathy-0.232
Instability index50.66
Isoelectric point8.89
Molecular weight169068.07
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09270
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     282.46|      67|      96|    1207|    1273|       1
---------------------------------------------------------------------------
  957- 1018 (79.64/40.81)	..PALER...GW.EKTDDTRRVFAILL.TRIRVFDAHH..FDKL...MTDWTS.HvrSLSSRPPLVSLfPLLVST...
 1207- 1273 (112.36/60.65)	PQPNANE...GQ.DQGSSRFEVFAKAM.DRAIEAGNIM..WTSLLPCLSDDIT.H..HLKSQAQSVFL.ELIPSSKAP
 1302- 1373 (90.47/47.38)	PPPKVAQlssGMvDKLTDLWEIIAAGThERPNCYAAVLqhW...LPAMLRFITlH..SLSSEPPSAPL.PTASATRPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     158.29|      54|      97|      14|      67|       2
---------------------------------------------------------------------------
   14-   59 (74.54/37.99)	...................................................PQRSVSSSSLPV............QRPPPQRTL.SHQQHFVPASPVRKDSSFIDLTADA
   60-  155 (43.52/18.93)	GDTTPNRYnttprrggsrlrlelshnasasslptsespqsltpsripansdPFQTVVGSPVPInsanstsmpmptRRP..............IASHLRSAPPVTTTTTPA
  159-  207 (40.24/16.91)	KDTRPKPY..............................tvevpsaapryfaANRPETTPRNPV............D..PFSKGLnSGYADFFP.................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.82|      26|      96|     693|     718|       3
---------------------------------------------------------------------------
  693-  718 (44.04/28.21)	LPL...HALSDKKRAERGNLLRRAGNYSI
  738-  766 (36.00/21.51)	LPLspgDPLSERKPVSLKRLLPRLSSSSG
  792-  812 (34.78/20.49)	LPL....TMYNSVRA....IMETAEDYSM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.63|      20|     430|     431|     470|      10
---------------------------------------------------------------------------
  396-  423 (28.11/42.19)	WKARV...TYAIRLATNLYSEqlldrdhyLD
  448-  470 (31.52/21.05)	WKDILrfrKYGRRLVFALLSH........LH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09270 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MTSRTPMGAHPRPPQRSVSSSSLPVQRPPPQRTLSHQQHFVPASPVRKDSSFIDLTADAGDTTPNRYNTTPRRGGSRLRLELSHNASASSLPTSESPQSLTPSRIPANSDPFQTVVGSPVPINSANSTSMPMPTRRPIASHLRSAPPVTTTTTPALSKKDTRPKPYTVEVPSAAPRYFAANRPETTPRNPVDPF
1
194










Molecular Recognition Features






MoRF SequenceStartStop




NANANA