<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09262

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMENPTAAGDAMRAAIEYWCQFVARCVSERLETDKFEAYVKIVHDQHPLPPTLVADFFLRPQPSDDSSLDPRIPPYLQVLTKLGYVDTPSILRALYKYSSSHAHAQAQKEHLQSNTEEGKGKEKEKQKENRDGKEKVEEKDDAQPKNITRWKSSYWAEEVLFYRLTKSVVEGRAIQDSRTALEVAMIISKFMELFTTALPATAFAADMLEQQFPTGQLRDEMESSRAALVALLLRLCENNILVSAIGKPFAKNARKALSTSLASFLPALQLVPEIADKLELFRTEILASSDPADKKKQVANAAMDELLDSTVGLENFVVAPISVSNTRAGLYIYLNAALIGRPILDDHALFSYMSNKYGADIQSSAIDLILASFDILANAVFRNEGQKDAHLLRSFLINKLPLLLYQLLPPGFSGTSAEFCITEALTHVDTSLFPTASLMFDESRNNNPYTESIREEFCAACVLHGLVQREHVERILGEISLSYEPSLQKHSKDKLVQDCLSDTDKIQGLVRELDKTDGNVGAVCQALVEVLRQSCHNKETMSLKLLCSQLAAKPQSLDVILLFEKLPNIIEPLCQLLDNWRYEEDQGEYQPVYEEFGAVLLLVFAFTYRYNLNAVDIGIATPDSWVAKIIGRGHIGRQGDELTQRENDHINGWVHGLFDTEAGGLGDELMSSCPPQEFYLIVAPLFQSIVVAYTYGYLNDESLKGGIEYLVDTFLLPSLVPAIRFLSDYLWIDQKEQKSIIKILQLILLPSSISGEASTMLSSVKNLIAKPLEHALRTYQRRDPKNQDIEPLLRTLKESVTLSRRTGGTDLNELESWTATPPSGLPSAVKLTIQGLVHWSIHPAMNSMPTSYTHRQILAGLKILGPRRLLHVILEEVRQHTAAGSANIIYDVATSLICAPDAVKDAPVTGMLDANGNMLPPIQRQRTLRDILKVEVQGCRKLQKEDPVLAEHMVRLHRRVETQMIIPQPQEMLQPADMSLNLADDTAALGDAMAAAASGVQGDNMSVDNLALDVSMGGVSSDMGLGSATDGGNLDPSGDAAMFEGFDTQDMDNFNWNITDTF
Length1062
PositionTail
OrganismFusarium poae
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
Aromaticity0.07
Grand average of hydropathy-0.165
Instability index44.54
Isoelectric point5.05
Molecular weight117797.06
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP09262
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      87.06|      29|      47|     499|     527|       1
---------------------------------------------------------------------------
  499-  527 (49.14/28.85)	CLS.DTDKIQGLVREL.............DKTDGNVGAVCQAL
  535-  577 (37.93/20.73)	CHNkETMSLKLLCSQLaakpqsldvillfEKLPNIIEPLCQLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.61|      28|     146|     746|     783|       2
---------------------------------------------------------------------------
  407-  454 (39.88/21.27)	LLPPGFSGTsaefcitealthvdtslfptASLMFDESRN..NNPYTESIR
  748-  777 (42.73/44.25)	LLPSSISGE....................ASTMLSSVKNliAKPLEHALR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     145.29|      47|      84|     180|     228|       7
---------------------------------------------------------------------------
  180-  228 (69.90/64.20)	ALEVAMIISKFMELFTTALPATAFAADMlEQQFPTGQLrDEMESSRAAL
  267-  313 (75.39/58.25)	ALQLVPEIADKLELFRTEILASSDPADK.KKQVANAAM.DELLDSTVGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.96|      17|      23|     921|     937|      10
---------------------------------------------------------------------------
  921-  937 (27.83/17.64)	PIQRQRTLRDILKVEVQ
  947-  963 (29.13/18.78)	PVLAEHMVRLHRRVETQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP09262 with Med5 domain of Kingdom Fungi
Unable to open file!