Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MASISPEQLKVLEQTRQRLVQLTQSLVSLINNINQSDPLPPWSSLQSQATIISNNLLNVSQQLTDHQDLLSSLVAYPTPQFPGRTEAAMLSQLLRTKLEPRVEDWVSQGLSMGSSDATTLKTGLTEQQLADLWQWAPVEANMEARRRNWGGDYTLEEKEMGVKNVVTGLRRKLSEDDSGSESGSEEDEEAGSEGEESRQEEGDGSGMEVVGVHRRPGGGGVEFDISKEGRHVPPTPMSPALPLEDVFRFMMTGVAPRSH |
Length | 259 |
Position | Head |
Organism | Emmonsia sp. CAC-2015a |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia> unclassified Emmonsia. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.605 |
Instability index | 71.41 |
Isoelectric point | 4.68 |
Molecular weight | 28495.38 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09258 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.23| 22| 42| 151| 172| 2 --------------------------------------------------------------------------- 151- 172 (36.44/18.33) GDYTLEEKEMGVKNVVTGLRRK 194- 215 (37.79/19.21) GEESRQEEGDGSGMEVVGVHRR --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FDISK 2) LPLEDVFRFMMTGVAPRS | 223 241 | 227 258 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab