Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MAQENPPDPPIPNLENPRFTLELEFVLSLANPHYISHLAVTYPHLLGVSASSASSSSRAAEEASSFTPTSDAQSFAAYLSYLYSYWKRPEYVQFLTHPGATLRALRLLQDESFRQAVIRPQVIEALLGTGVEDAAVVGAGENNNDKGAQNEPEAGKKTELSGSEGRNGIET |
Length | 171 |
Position | Middle |
Organism | Emmonsia sp. CAC-2015a |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia> unclassified Emmonsia. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.388 |
Instability index | 43.80 |
Isoelectric point | 4.85 |
Molecular weight | 18520.25 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP09247 No repeats found |
IDR Sequence | Start | Stop |
1) VVGAGENNNDKGAQNEPEAGKKTELSGSEGRNGIET | 136 | 171 |
MoRF Sequence | Start | Stop |
1) EAGKKTELS 2) FAAYLSYLY | 153 75 | 161 83 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab