| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MPTVLKTRDDEKKSLTLSLSTLSEHSQPDPSTSPSQTTPRINDPDPPVQSVQLPPEIIDYVDAARNPDIYTREFVELVQRGNQDLKGKAEAFANFRDVLAREMVSAMPECNGEVERVLRATGGRVGGESGASDGGLDSGITDVRPGNESGNGE |
| Length | 153 |
| Position | Middle |
| Organism | Emmonsia sp. CAC-2015a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia> unclassified Emmonsia. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.708 |
| Instability index | 35.43 |
| Isoelectric point | 4.58 |
| Molecular weight | 16451.90 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09243
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.13| 15| 15| 27| 41| 1
---------------------------------------------------------------------------
27- 41 (28.89/14.18) QPDPSTSPSQTTPRI
43- 57 (29.23/14.42) DPDPPVQSVQLPPEI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LDSGITDVRPGN 2) VQSVQLPPEIIDYVDAARNPDIYTREFVELVQRGN | 136 48 | 147 82 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab