| Description | Mediator of RNA polymerase II transcription subunit 20 (Fragment) |
| Sequence | MPVTGLYFIPANQNSPTATGNVIERLRSAYNPSLCGRWALEHRLLRDTPSCLPPSDYAPLPPLQPRFMQFLSLSHRQPYGFIYISDRPAPDPWDPVPSGATHAGHAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ |
| Length | 135 |
| Position | Head |
| Organism | Emmonsia sp. CAC-2015a |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia> unclassified Emmonsia. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -1.058 |
| Instability index | 94.56 |
| Isoelectric point | 7.86 |
| Molecular weight | 15497.00 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP09242
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.43| 13| 15| 107| 119| 1
---------------------------------------------------------------------------
107- 119 (28.21/ 8.18) QQQQQQQQQQQQQ
123- 135 (28.21/ 8.18) QQQQQQQQQQQQQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) VTGLY 2) YAPLPPLQPRFMQFLSLSHRQPYGFIYISDRPAPDPWDPVPSGATHAGHAQQQQQQQQQQ | 3 57 | 7 116 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab