<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP09241
Description |
Uncharacterized protein |
Sequence | MADILTQLQTCLDQLATQFYATLCYISTYHDHSVATPPSNVPTAIPQLKKIPKNPPPATTTSAAEKAAGGTAASPQPQQPNTPGGADAKTQQLESPTEPPPDSPEVFAQRQRELARDLIVKEQQVEYLIGVLPGVGSSEAEQEERIRQLAEELRVVEAERRVKRKEMRKLGERVDELLGAVEGRR |
Length | 185 |
Position | Middle |
Organism | Emmonsia sp. CAC-2015a |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Onygenales> Ajellomycetaceae> Emmonsia>
unclassified Emmonsia.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.645 |
Instability index | 59.34 |
Isoelectric point | 5.36 |
Molecular weight | 20274.62 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP09241
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.21| 19| 42| 38| 57| 1
---------------------------------------------------------------------------
38- 57 (33.69/20.54) PS..NVP....TAIPQLKKiPKNPPP
77- 101 (27.52/12.36) PQqpNTPggadAKTQQLES.PTEPPP
---------------------------------------------------------------------------
|